PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00208.200
Common NameLOC105637454
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NAC
Protein Properties Length: 329aa    MW: 36688.4 Da    PI: 8.7673
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00208.200genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.44e-55111381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL  k+++ +++  ++i++vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++
  Jcr4S00208.200  11 LPPGFRFHPTDEELITCYLVSKISDANFTG-RAIADVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNS 104
                     79*************************999.89***************99999****************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++el+g+kktLvfy+grap+gekt+Wvmheyr+
  Jcr4S00208.200 105 vSSELIGMKKTLVFYRGRAPRGEKTNWVMHEYRI 138
                     89999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-648159IPR003441NAC domain
PROSITE profilePS5100560.26911159IPR003441NAC domain
PfamPF023656.9E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEGADRKEES LPPGFRFHPT DEELITCYLV SKISDANFTG RAIADVDLNK CEPWDLPGKA  60
KMGEKEWYFF SLRDRKYPTG VRTNRATNTG YWKTTGKDKE IFNSVSSELI GMKKTLVFYR  120
GRAPRGEKTN WVMHEYRIHS KSAFRTTKDE WVVCRVFQKS AGAKKYPSNQ SRGAVNPYNL  180
EMGANVMMQQ AVDNYQFPVG RNYMSQAELA ELTRALRAGE STSLSLPLQS QMNYPPLGPP  240
GSSFTISGLN LNLGGASIYR PLQPQPPPPP PAVINQQDVN SSIITAAPSF AAEAAHAYAA  300
DMNSAANAST NRFLGVEHCM DLDNYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-571016519174NAC domain-containing protein 19
3swm_B2e-571016519174NAC domain-containing protein 19
3swm_C2e-571016519174NAC domain-containing protein 19
3swm_D2e-571016519174NAC domain-containing protein 19
3swp_A2e-571016519174NAC domain-containing protein 19
3swp_B2e-571016519174NAC domain-containing protein 19
3swp_C2e-571016519174NAC domain-containing protein 19
3swp_D2e-571016519174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7752840.0KC775284.1 Jatropha curcas NAC transcription factor 006 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020536653.10.0protein CUP-SHAPED COTYLEDON 2 isoform X1
RefseqXP_020536654.10.0protein CUP-SHAPED COTYLEDON 2 isoform X2
SwissprotO040179e-82NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLR4N5I80.0R4N5I8_JATCU; NAC transcription factor 006
STRINGcassava4.1_011442m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-106NAC domain containing protein 38
Publications ? help Back to Top
  1. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  2. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  3. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  4. Wu Z, et al.
    Genome-Wide Analysis of the NAC Gene Family in Physic Nut (Jatropha curcas L.).
    PLoS ONE, 2015. 10(6): p. e0131890
    [PMID:26125188]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Vialette-Guiraud AC, et al.
    A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
    Front Plant Sci, 2015. 6: p. 1239
    [PMID:26793217]
  7. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  8. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]
  9. Biot E, et al.
    Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis.
    Development, 2016. 143(18): p. 3417-28
    [PMID:27387872]
  10. Zheng M, et al.
    Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development.
    Plant Physiol., 2016. 172(2): p. 1117-1130
    [PMID:27535792]
  11. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  12. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  13. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]
  14. Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
    Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.
    New Phytol., 2018. 217(3): p. 1307-1321
    [PMID:29139551]
  15. Gonçalves B, et al.
    GDP-L-fucose is required for boundary definition in plants.
    J. Exp. Bot., 2017. 68(21-22): p. 5801-5811
    [PMID:29186469]
  16. Sha S, et al.
    To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes.
    Ann. Bot., 2018. 121(2): p. 255-266
    [PMID:29267935]
  17. Maugarny-Calès A, et al.
    Dissecting the pathways coordinating patterning and growth by plant boundary domains.
    PLoS Genet., 2019. 15(1): p. e1007913
    [PMID:30677017]