PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han007602
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family G2-like
Protein Properties Length: 189aa    MW: 20792.9 Da    PI: 4.4374
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S48335342PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like56.94.5e-18141189150
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHL 50 
                k +++WtpeLH+rFv+aveqL G +kA+  +ile+ ++ +Lt+++++SHL
  Han007602 141 KVKVDWTPELHRRFVQAVEQL-GVDKAVSFRILEIRGIGCLTRHNIASHL 189
                5689*****************.***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.68138189IPR017930Myb domain
SuperFamilySSF466894.84E-12139189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-16139189IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-17141189IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLAIVSPLGT NTGRDVRDQG CDHSVGFSVG NEFPDFSDDN LLESIDFDDL FVGMDDQDML  60
PDLEMDPELL TGEFSLGGGE EPCELNNNSV TSFSSDKKDE DLTASKEAPA TNLAPKQKET  120
NVRGMKSLSD KSKNSSXGKR KVKVDWTPEL HRRFVQAVEQ LGVDKAVSFR ILEIRGIGCL  180
TRHNIASHL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022037720.11e-128transcription activator GLK1 isoform X1
RefseqXP_022037721.11e-129transcription activator GLK1 isoform X2
TrEMBLA0A251UPJ21e-127A0A251UPJ2_HELAN; Putative GBF's pro-rich region-interacting factor 1
STRINGXP_009601765.16e-50(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-32GOLDEN2-like 2