![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Han002848 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 237aa MW: 27120.1 Da PI: 9.5676 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171 | 3.6e-53 | 6 | 131 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrF Ptdeel+v+yL++kv+g++++l ++i+++d+yk++Pw+Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+ v Han002848 6 LPPGFRFYPTDEELLVQYLCRKVAGHDFSL-QIIADIDLYKFDPWQLPSKAMFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-EGRRV 103 79***************************9.89***************8777899*************************************99.9999* PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kk Lvfy g+apkg+kt+W+mheyrl Han002848 104 GIKKALVFYVGKAPKGNKTNWIMHEYRL 131 **************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.93E-67 | 3 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.151 | 6 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-26 | 7 | 131 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MTQLSLPPGF RFYPTDEELL VQYLCRKVAG HDFSLQIIAD IDLYKFDPWQ LPSKAMFGEK 60 EWYFFSPRDR KYPNGSRPNR VAGSGYWKAT GTDKVITTEG RRVGIKKALV FYVGKAPKGN 120 KTNWIMHEYR LSDPQRKTGS SRLDEWVLCR IYKKNSSAQK TISGGQTTEQ SHGSPSSSSS 180 QFDDVLESLP EIQDRCFNLT RVNSIKTFXQ EEPKLNLQKF DSGHYDWASI ASFGLPX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-105 | 1 | 160 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-105 | 1 | 160 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-105 | 1 | 160 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-105 | 1 | 160 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-105 | 1 | 160 | 15 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-105 | 1 | 160 | 12 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-105 | 1 | 160 | 12 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021992825.1 | 1e-163 | NAC domain-containing protein 72-like | ||||
Swissprot | A0A3Q7HH64 | 1e-133 | JA2L_SOLLC; NAC domain-containing protein JA2L | ||||
TrEMBL | A0A251T7X7 | 1e-162 | A0A251T7X7_HELAN; Putative NAC (No Apical Meristem) domain transcriptional regulator superfamily protein | ||||
STRING | XP_009594219.1 | 1e-132 | (Nicotiana tomentosiformis) | ||||
STRING | PGSC0003DMT400049665 | 1e-132 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G27410.2 | 1e-116 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|