PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han001529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family BES1
Protein Properties Length: 299aa    MW: 32429.1 Da    PI: 8.8704
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S32092532PU_unrefUnigeneView CDS
PUT-169a-Helianthus_annuus-14583PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.91.9e-6661472145
     DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkss 101
                ++gr p+wkErEnnkrRERrRRaiaakiyaGLR+ Gny+lpk++DnneVlkALc+eAGwvve+DGtty+kg+kp+  +e+ag s+++s++ss+q s+ ss
  Han001529   6 STGRLPSWKERENNKRRERRRRAIAAKIYAGLRSLGNYRLPKHCDNNEVLKALCAEAGWVVEEDGTTYPKGCKPP-PSEIAGMSTNRSTCSSIQPSPMSS 104
                789************************************************************************.************************ PP

     DUF822 102 alaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                a++sp++sy+asp+sssfpsp++ ++ +++s + +lp+l +ls+
  Han001529 105 AFPSPAPSYHASPTSSSFPSPTRCENPPNHS-SYILPYLCNLSS 147
                ************************9998875.677777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.3E-627130IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTGGASTGRL PSWKERENNK RRERRRRAIA AKIYAGLRSL GNYRLPKHCD NNEVLKALCA  60
EAGWVVEEDG TTYPKGCKPP PSEIAGMSTN RSTCSSIQPS PMSSAFPSPA PSYHASPTSS  120
SFPSPTRCEN PPNHSSYILP YLCNLSSLPP LRISNSAPVT PPLSSPTGRG TKRKPNWEML  180
STSALQSFRH PLFAASAPSS PTRRHRVPPA TIPECDESDA STVDSGRWVS FQTMTASAAP  240
TSPTFNLVKP ASQQPFFQNG LVVQNGPGSE FEFEAXTLKA WEGERIHEVG AEDLELTLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A9e-29989372452Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B9e-29989372452Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C9e-29989372452Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D9e-29989372452Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Han.32560.0embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Accumulates in the growing region of the hypocotyl. {ECO:0000269|PubMed:11970900}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter. Regulates positively the brassinosteroid-signaling pathway. Mediates downstream growth responses and negative feedback regulation of brassinosteroid biosynthesis. Promotes growth. Modulates ovule initiation and development by monitoring the expression of genes related to ovule development (e.g. HLL, ANT, and AP2). {ECO:0000269|PubMed:15681342, ECO:0000269|PubMed:22914576}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroid (BR). {ECO:0000269|PubMed:15681342}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022009655.10.0BES1/BZR1 homolog protein 2-like
SwissprotQ8S3071e-104BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A251SKK80.0A0A251SKK8_HELAN; Putative BES1/BZR1-like protein
STRINGXP_009349751.11e-131(Pyrus x bretschneideri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.23e-85BES1 family protein
Publications ? help Back to Top
  1. Wang H, et al.
    Dual role of BKI1 and 14-3-3 s in brassinosteroid signaling to link receptor with transcription factors.
    Dev. Cell, 2011. 21(5): p. 825-34
    [PMID:22075146]
  2. Liu L, et al.
    Ectopic expression of a BZR1-1D transcription factor in brassinosteroid signalling enhances carotenoid accumulation and fruit quality attributes in tomato.
    Plant Biotechnol. J., 2014. 12(1): p. 105-15
    [PMID:24102834]
  3. Kim B, et al.
    Darkness and gulliver2/phyB mutation decrease the abundance of phosphorylated BZR1 to activate brassinosteroid signaling in Arabidopsis.
    Plant J., 2014. 77(5): p. 737-47
    [PMID:24387668]
  4. He X, et al.
    A genotypic difference in primary root length is associated with the inhibitory role of transforming growth factor-beta receptor-interacting protein-1 on root meristem size in wheat.
    Plant J., 2014. 77(6): p. 931-43
    [PMID:24467344]
  5. Oh E, et al.
    Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl.
    Elife, 2015.
    [PMID:24867218]
  6. Zhang D,Jing Y,Jiang Z,Lin R
    The Chromatin-Remodeling Factor PICKLE Integrates Brassinosteroid and Gibberellin Signaling during Skotomorphogenic Growth in Arabidopsis.
    Plant Cell, 2014. 26(6): p. 2472-2485
    [PMID:24920333]
  7. Shimada S, et al.
    Formation and dissociation of the BSS1 protein complex regulates plant development via brassinosteroid signaling.
    Plant Cell, 2015. 27(2): p. 375-90
    [PMID:25663622]
  8. Chaiwanon J,Wang ZY
    Spatiotemporal brassinosteroid signaling and antagonism with auxin pattern stem cell dynamics in Arabidopsis roots.
    Curr. Biol., 2015. 25(8): p. 1031-42
    [PMID:25866388]
  9. Zhang Y, et al.
    Brassinosteroid is required for sugar promotion of hypocotyl elongation in Arabidopsis in darkness.
    Planta, 2015. 242(4): p. 881-93
    [PMID:25998528]
  10. Jiang J, et al.
    The Intrinsically Disordered Protein BKI1 Is Essential for Inhibiting BRI1 Signaling in Plants.
    Mol Plant, 2015. 8(11): p. 1675-8
    [PMID:26296798]
  11. Zhang Y,He J
    Sugar-induced plant growth is dependent on brassinosteroids.
    Plant Signal Behav, 2015. 10(12): p. e1082700
    [PMID:26340221]
  12. Anne P, et al.
    OCTOPUS Negatively Regulates BIN2 to Control Phloem Differentiation in Arabidopsis thaliana.
    Curr. Biol., 2015. 25(19): p. 2584-90
    [PMID:26387715]
  13. Wang R, et al.
    The Brassinosteroid-Activated BRI1 Receptor Kinase Is Switched off by Dephosphorylation Mediated by Cytoplasm-Localized PP2A B' Subunits.
    Mol Plant, 2016. 9(1): p. 148-157
    [PMID:26517938]
  14. Youn JH, et al.
    ARF7 increases the endogenous contents of castasterone through suppression of BAS1 expression in Arabidopsis thaliana.
    Phytochemistry, 2016. 122: p. 34-44
    [PMID:26608667]
  15. Chaiwanon J,Garcia VJ,Cartwright H,Sun Y,Wang ZY
    Immunophilin-like FKBP42/TWISTED DWARF1 Interacts with the Receptor Kinase BRI1 to Regulate Brassinosteroid Signaling in Arabidopsis.
    Mol Plant, 2016. 9(4): p. 593-600
    [PMID:26808213]
  16. Yang X,Bai Y,Shang J,Xin R,Tang W
    The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1.
    Plant Cell Environ., 2016. 39(9): p. 1994-2003
    [PMID:27149247]
  17. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  18. Zhang Z, et al.
    TOR Signaling Promotes Accumulation of BZR1 to Balance Growth with Carbon Availability in Arabidopsis.
    Curr. Biol., 2016. 26(14): p. 1854-60
    [PMID:27345161]
  19. Zhang Y, et al.
    Functional characterization of GmBZL2 (AtBZR1 like gene) reveals the conserved BR signaling regulation in Glycine max.
    Sci Rep, 2016. 6: p. 31134
    [PMID:27498784]
  20. Favero DS,Le KN,Neff MM
    Brassinosteroid signaling converges with SUPPRESSOR OF PHYTOCHROME B4-#3 to influence the expression of SMALL AUXIN UP RNA genes and hypocotyl growth.
    Plant J., 2017. 89(6): p. 1133-1145
    [PMID:27984677]
  21. Li H, et al.
    BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis.
    Mol Plant, 2017. 10(4): p. 545-559
    [PMID:28089951]
  22. Zentella R, et al.
    The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
    Nat. Chem. Biol., 2017. 13(5): p. 479-485
    [PMID:28244988]
  23. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  24. Li QF, et al.
    Light involved regulation of BZR1 stability and phosphorylation status to coordinate plant growth in Arabidopsis.
    Biosci. Rep., 2018.
    [PMID:28396515]
  25. Thussagunpanit J, et al.
    Characterization of synthetic ecdysteroid analogues as functional mimics of brassinosteroids in plant growth.
    J. Steroid Biochem. Mol. Biol., 2017. 172: p. 1-8
    [PMID:28479230]
  26. Zhu JY, et al.
    The F-box Protein KIB1 Mediates Brassinosteroid-Induced Inactivation and Degradation of GSK3-like Kinases in Arabidopsis.
    Mol. Cell, 2017. 66(5): p. 648-657.e4
    [PMID:28575660]
  27. Yang M,Wang X
    Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants.
    Mol Plant, 2017. 10(7): p. 915-917
    [PMID:28629641]
  28. Lv B, et al.
    Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis.
    PLoS Genet., 2018. 14(1): p. e1007144
    [PMID:29324765]
  29. IbaƱez C, et al.
    Brassinosteroids Dominate Hormonal Regulation of Plant Thermomorphogenesis via BZR1.
    Curr. Biol., 2018. 28(2): p. 303-310.e3
    [PMID:29337075]
  30. Saito M,Kondo Y,Fukuda H
    BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation.
    Plant Cell Physiol., 2018. 59(3): p. 590-600
    [PMID:29385529]
  31. Li QF, et al.
    The brassinosteroid-regulated transcription factors BZR1/BES1 function as a coordinator in multisignal-regulated plant growth.
    Biochim Biophys Acta Gene Regul Mech, 2018. 1861(6): p. 561-571
    [PMID:29673687]
  32. Nosaki S, et al.
    Structural basis for brassinosteroid response by BIL1/BZR1.
    Nat Plants, 2018. 4(10): p. 771-776
    [PMID:30287951]