![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN02357.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 89aa MW: 9781.57 Da PI: 10.5601 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133.2 | 6.3e-42 | 26 | 89 | 7 | 70 |
S1FA 7 eakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 +k +nPGlivllvvgglll+fl+gny+ly+yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe KHN02357.1 26 GSKAFNPGLIVLLVVGGLLLTFLIGNYVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 89 579************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 2.0E-5 | 22 | 89 | No hit | No description |
Pfam | PF04689 | 3.4E-40 | 26 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MADDFDFADK VPPSFDRVGN VIKDSGSKAF NPGLIVLLVV GGLLLTFLIG NYVLYTYAQK 60 TLPPRKKKPV SKKKMKKERL KQGVSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN02357.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT089697 | 1e-149 | BT089697.1 Soybean clone JCVI-FLGm-2J23 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003554367.1 | 1e-57 | DNA-binding protein S1FA | ||||
Refseq | XP_028215942.1 | 1e-57 | DNA-binding protein S1FA-like | ||||
Swissprot | Q7XLX6 | 6e-16 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A445FI17 | 3e-56 | A0A445FI17_GLYSO; DNA-binding protein S1FA2 | ||||
TrEMBL | C6SX03 | 3e-56 | C6SX03_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA19G36350.1 | 6e-57 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09735.1 | 7e-08 | S1FA-like DNA-binding protein |
Publications ? help Back to Top | |||
---|---|---|---|
|