![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G135200.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 198aa MW: 22654.6 Da PI: 7.5444 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.6 | 2.5e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs +gklye + Gorai.013G135200.1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVVIFSAHGKLYELA 58 79*********************************************965 PP | |||||||
2 | K-box | 58.3 | 3.2e-20 | 89 | 172 | 17 | 100 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++e++ Lk+eie Lq+ R + G + e +sl+eL Le++Le +++iRs+K ++++++i+ l++ke + +nk+L++ +ee Gorai.013G135200.1 89 AKKEIEMLKQEIEILQKGPRYMFGGGCEYMSLNELLVLEKHLEIWINHIRSTKIDIMFQEIQMLRNKEGIMTAANKCLHETIEE 172 579*****************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.249 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-28 | 1 | 75 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.0E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.12E-41 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.7E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.057 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.9E-20 | 89 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MGRGRVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVVIFSA HGKLYELATK 60 GTMQELIERY GKYTGGPPAD EPMVEPMDAK KEIEMLKQEI EILQKGPRYM FGGGCEYMSL 120 NELLVLEKHL EIWINHIRST KIDIMFQEIQ MLRNKEGIMT AANKCLHETI EENISYTDFT 180 TMTTNMMHPL TIANNIF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-17 | 1 | 90 | 1 | 91 | MEF2C |
5f28_B | 5e-17 | 1 | 90 | 1 | 91 | MEF2C |
5f28_C | 5e-17 | 1 | 90 | 1 | 91 | MEF2C |
5f28_D | 5e-17 | 1 | 90 | 1 | 91 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ518914 | 4e-63 | DQ518914.1 Populus tomentosa MADS box transcription factor (MADS2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012465887.1 | 1e-146 | PREDICTED: agamous-like MADS-box protein AGL12 isoform X2 | ||||
Swissprot | Q38841 | 1e-74 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A2P5YFF0 | 1e-142 | A0A2P5YFF0_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.013G135200.1 | 1e-145 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7052 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 6e-77 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G135200.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|