![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.003G093300.1 | ||||||||
Common Name | B456_003G093300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 167aa MW: 18624.1 Da PI: 10.545 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 106.1 | 2.9e-33 | 9 | 65 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh hA+rR+Rg+gGrF Gorai.003G093300.1 9 EEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHLHAMRRARGCGGRF 65 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.0E-37 | 7 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.337 | 8 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.1E-28 | 10 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.7E-24 | 11 | 33 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 13 | 33 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.7E-24 | 42 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MALPLEMAEE PVYVNAKQYH GILRRRQSRA KAELEKKLIK VRKPYLHESR HLHAMRRARG 60 CGGRFLNTKK LGTDASNAVP NRGSDSASSN LSSVGHGESK ESQLQGTNNQ QQALSNANGC 120 YPHHERFLFS TSGSLSDKMM EGDCPRQQQR ERIMANQVPH MALTIK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-21 | 9 | 80 | 2 | 77 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012472445.1 | 1e-120 | PREDICTED: nuclear transcription factor Y subunit A-7-like, partial | ||||
TrEMBL | A0A0D2QQN3 | 1e-120 | A0A0D2QQN3_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.003G093300.1 | 1e-121 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15602 | 10 | 15 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 2e-35 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.003G093300.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|