PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.03G118100.1.p | ||||||||
Common Name | GLYMA_03G118100, LOC100803262 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 227aa MW: 25489.2 Da PI: 7.6359 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.3 | 2.5e-19 | 139 | 173 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+C t kTp+WR gp g+ktLCnaCG+++++ +l Glyma.03G118100.1.p 139 CSHCATDKTPQWRTGPLGPKTLCNACGVRFKSGRL 173 *******************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.3E-16 | 133 | 183 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.319 | 137 | 169 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.1E-14 | 137 | 171 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 6.65E-15 | 137 | 197 | No hit | No description |
CDD | cd00202 | 6.33E-15 | 138 | 185 | No hit | No description |
Pfam | PF00320 | 3.5E-17 | 139 | 173 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 139 | 164 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MDLYGSFSTP SDCLHIDDFL DFSNITTTTT DTHHHFPPPQ NSPSISHDPN FFLNFPSVPS 60 DEAVELEWLS QFVNDEATSF HNIPPPASIG SHTTPFLSNN NRNDNNNEYP KSSSSSPVLA 120 GKSRARREGS VTGDGVRRCS HCATDKTPQW RTGPLGPKTL CNACGVRFKS GRLVPEYRPA 180 ASPTFVMTQH SNSHRKVMEL RRQKELLRHQ QQEQCYRHTH HDFKVC* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.10573 | 0.0 | hypocotyl| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in flowers and leaves, and to a lower extent in stems. {ECO:0000269|PubMed:12139008}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.03G118100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003521089.1 | 1e-169 | GATA transcription factor 2 | ||||
Refseq | XP_028225097.1 | 1e-169 | GATA transcription factor 2-like | ||||
Swissprot | O49741 | 8e-56 | GATA2_ARATH; GATA transcription factor 2 | ||||
TrEMBL | A0A445LAD3 | 1e-168 | A0A445LAD3_GLYSO; GATA transcription factor 2 | ||||
TrEMBL | I1JMW7 | 1e-168 | I1JMW7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G27250.1 | 1e-169 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13550 | 19 | 25 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45050.1 | 8e-58 | GATA transcription factor 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.03G118100.1.p |
Entrez Gene | 100803262 |
Publications ? help Back to Top | |||
---|---|---|---|
|