PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS65941.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

GRF

Protein Properties

Length: 103aa MW: 12114 Da PI: 9.9597

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS65941.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	81.4	8.1e-26	57	101	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+++ + +k+CErH+hrgr+rsrk++e+ EPS65941.1 57 DPEPGRCRRTDGKKWRCSKEAFPESKYCERHMHRGRNRSRKPVET 101 79****************************************985 PP
2	QLQ	48.8	2.1e-17	1	32	6	37
QLQ 6 aQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i++ EPS65941.1 1 SQWQELEHQALVYKYIISGIPIPPDLLFSIRR 32 6***************************9985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	3.0E-5	1	32	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	4.6E-12	1	31	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	19.139	1	32	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	24.972	57	101	IPR014977	WRC domain
Pfam	PF08879	8.1E-22	58	100	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
SQWQELEHQA LVYKYIISGI PIPPDLLFSI RRSCLLLDAV AEPFHHFVGF HVGRKVDPEP 60 GRCRRTDGKK WRCSKEAFPE SKYCERHMHR GRNRSRKPVE TLS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:24532604, ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749, ECO:0000305\|PubMed:26187814, ECO:0000305\|PubMed:27107174, ECO:0000305\|PubMed:27250747, ECO:0000305\|PubMed:27250749}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022147550.1	2e-49	growth-regulating factor 6 isoform X1
Refseq	XP_022147551.1	2e-49	growth-regulating factor 6 isoform X2
Refseq	XP_022147552.1	2e-49	growth-regulating factor 6 isoform X3
Swissprot	Q6ZIK5	2e-45	GRF4_ORYSJ; Growth-regulating factor 4
TrEMBL	S8CME3	7e-71	S8CME3_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009361693.1	1e-47	(Pyrus x bretschneideri)
STRING	XP_008450915.1	8e-48	(Cucumis melo)
STRING	XP_008363050.1	3e-48	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7032	22	30

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13960.1	1e-43	growth-regulating factor 5

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Hu J, et al. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice. Mol Plant, 2015. 8(10): p. 1455-65 [PMID:26187814] Sun P, et al. OsGRF4 controls grain shape, panicle length and seed shattering in rice. J Integr Plant Biol, 2016. 58(10): p. 836-847 [PMID:26936408] Li S, et al. The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice. Plant Biotechnol. J., 2016. 14(11): p. 2134-2146 [PMID:27107174] Che R, et al. Control of grain size and rice yield by GL2-mediated brassinosteroid responses. Nat Plants, 2015. 2: p. 15195 [PMID:27250747] Duan P, et al. Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice. Nat Plants, 2015. 2: p. 15203 [PMID:27250749]