PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna14869.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 158aa MW: 18579.9 Da PI: 8.8715 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 182.8 | 8.3e-57 | 8 | 137 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyW 83 +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL+ ++e++ewyfFs++dkky+tg+r+nrat +g+W mrna14869.1-v1.0-hybrid 8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQDrcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFW 92 69****************************.9***************953432234667*************************** PP NAM 84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 katg+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle mrna14869.1-v1.0-hybrid 93 KATGRDKSVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137 ***********.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.01E-58 | 6 | 143 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.939 | 8 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.8E-30 | 9 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MESIESTVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLQDRCRIG 60 YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKS VYDKSKLIGM RKTLVFYKGR 120 APNGQKTDWI MHEYRLESDE NGPPQASDTE KHHRSPL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-51 | 5 | 136 | 12 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00471 | DAP | Transfer from AT4G36160 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna14869.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024183159.1 | 1e-105 | NAC domain-containing protein 37 | ||||
Swissprot | O65508 | 3e-99 | NAC76_ARATH; NAC domain-containing protein 76 | ||||
TrEMBL | A0A498KME8 | 1e-105 | A0A498KME8_MALDO; Uncharacterized protein | ||||
STRING | XP_004287828.1 | 1e-105 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4565 | 34 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36160.1 | 1e-101 | NAC domain containing protein 76 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna14869.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|