PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.C02105.1.p

Common Name

EUGRSUZ_C02105, LOC104437247

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NAC

Protein Properties

Length: 327aa MW: 36263.2 Da PI: 9.1354

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.C02105.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	177	5e-55	9	136	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeel+++yL +k+++++++ ++i++vd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++ Eucgr.C02105.1.p 9 LPPGFRFHPTDEELITYYLMNKISDSNFTG-RAITDVDLNKSEPWELPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIF 100 79***********************999.89***********99999************************************ PP NAM 94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ ++elvg+kktLvfykgrap+gek++Wvmheyr+ Eucgr.C02105.1.p 101 NSvTSELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 136 9989999*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-63	6	157	IPR003441	NAC domain
PROSITE profile	PS51005	60.773	9	157	IPR003441	NAC domain
Pfam	PF02365	1.1E-28	10	136	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 327 aa Download sequence Send to blast
MEEKKEDNLP PGFRFHPTDE ELITYYLMNK ISDSNFTGRA ITDVDLNKSE PWELPAKAKM 60 GEKEWYFFSL RDRKYPTGVR TNRATNTGYW KTTGKDKEIF NSVTSELVGM KKTLVFYKGR 120 APRGEKSNWV MHEYRIHSKS AFRTAKDEWV VCRVFQKSAG AKKYPSSQSR AVPPYSLEIG 180 SSVVPPTMMP PENFQFLSRN YMNGADLAEI NRVLRSGAMS VNQPMPPQLN PTGTSGGCFT 240 ISGLNLNLGG ATSQPVLRPV MQAPPGPAMS HQDMVVGSTM MSSSTALVGD QAGGYGGEMG 300 HANVGGNRYL GMENCMEMDN YWPPAY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-56	8	163	16	171	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-56	8	163	16	171	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-56	8	163	16	171	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-56	8	163	16	171	NO APICAL MERISTEM PROTEIN
3swm_A	8e-56	8	163	19	174	NAC domain-containing protein 19
3swm_B	8e-56	8	163	19	174	NAC domain-containing protein 19
3swm_C	8e-56	8	163	19	174	NAC domain-containing protein 19
3swm_D	8e-56	8	163	19	174	NAC domain-containing protein 19
3swp_A	8e-56	8	163	19	174	NAC domain-containing protein 19
3swp_B	8e-56	8	163	19	174	NAC domain-containing protein 19
3swp_C	8e-56	8	163	19	174	NAC domain-containing protein 19
3swp_D	8e-56	8	163	19	174	NAC domain-containing protein 19
4dul_A	9e-56	8	163	16	171	NAC domain-containing protein 19
4dul_B	9e-56	8	163	16	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00277	DAP	Transfer from AT2G24430	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.C02105.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010048462.1	0.0	PREDICTED: NAC domain-containing protein 92
Refseq	XP_010048463.1	0.0	PREDICTED: NAC domain-containing protein 92
Refseq	XP_010048464.1	0.0	PREDICTED: NAC domain-containing protein 92
Swissprot	O04017	2e-81	NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBL	A0A059CQF7	0.0	A0A059CQF7_EUCGR; Uncharacterized protein
STRING	XP_010048462.1	0.0	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6851	28	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G24430.2	1e-116	NAC domain containing protein 38

Link Out ? help Back to Top
Phytozome	Eucgr.C02105.1.p
Entrez Gene	104437247

Publications ? help Back to Top
Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] Biot E, et al. Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] Zheng M, et al. Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] Gonçalves B, et al. GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] Sha S, et al. To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] Maugarny-Calès A, et al. Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]