PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC036859.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 134aa MW: 15654.9 Da PI: 8.2246 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 119.2 | 5.3e-37 | 1 | 63 | 8 | 70 |
DUF702 8 CqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaea 70 CqdCGnqakkdC+h RCRtCCksrgf+C thvkstWvpaakrrerqq+la+a+ +++++++ EcC036859.10 1 CQDCGNQAKKDCVHLRCRTCCKSRGFECPTHVKSTWVPAAKRRERQQHLATAAVMHQQQQQQP 63 ************************************************999876665554332 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01623 | 9.6E-28 | 1 | 42 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 3.8E-35 | 1 | 81 | IPR007818 | Protein of unknown function DUF702 |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
CQDCGNQAKK DCVHLRCRTC CKSRGFECPT HVKSTWVPAA KRRERQQHLA TAAVMHQQQQ 60 QQPLRQEQPF HLDHYFKRQR DGEVAAAPPF PIATSGNSIG FERETEILWD FFPIARALDF 120 FLFYILRFET ICDL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010061013.1 | 1e-54 | PREDICTED: protein SHI RELATED SEQUENCE 1 | ||||
Swissprot | Q9XGX0 | 3e-28 | SHI_ARATH; Protein SHORT INTERNODES | ||||
TrEMBL | A0A059BQA6 | 4e-54 | A0A059BQA6_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061013.1 | 4e-54 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22621 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66350.1 | 1e-29 | Lateral root primordium (LRP) protein-related |
Publications ? help Back to Top | |||
---|---|---|---|
|