PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037696m
Common NameCISIN_1g037696mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 364aa    MW: 40909.8 Da    PI: 7.0111
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037696mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.6e-11228273550
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  orange1.1g037696m 228 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 273
                        8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-13224288IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703226278IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12228282No hitNo description
Gene3DG3DSA:1.20.5.1706.0E-14228279No hitNo description
PfamPF001709.7E-10228272IPR004827Basic-leucine zipper domain
CDDcd147036.88E-24229279No hitNo description
PROSITE patternPS000360231246IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MAQLPPKIPN MSHNWSSFPY QRMSFISSNN NNNNDNNNNN IANAATTMTL NNNNNIHHNQ  60
PHWVDEFLDF SSVRRGAHRR SISDSVAFLD PPSSLVVVEE CRNSNNSNNN NNNSTMNNIM  120
SSSDANYCFD RLDDEQLMSM FSDDISVSVP PTASSSNPST PSDQNSNNDE KVTAPSDQQQ  180
QQKQQQQQPK NEPGEVESSC KNNEPSSSQT TTHQTPPASN GDTIIDPKRV KRILANRQSA  240
QRSRVRKLQY ISELERSVTT LQTEVSALSP RVAFLDHQRL ILNVDNSALK QRIAALAQDK  300
IFKDAHQEAL KKEIERLRQV YHQQNIKKMK NNNNSNNNAT PPPQQPPSQP MNTDTIVCMD  360
KDQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451750.10.0basic leucine zipper 61 isoform X2
RefseqXP_006494850.10.0basic leucine zipper 61-like isoform X2
SwissprotQ9M2K41e-105BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A067EX710.0A0A067EX71_CITSI; Uncharacterized protein
STRINGXP_006494850.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-83bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]