PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g023462m
Common NameCISIN_1g023462mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Nin-like
Protein Properties Length: 283aa    MW: 30945.8 Da    PI: 9.6029
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g023462mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.23.7e-242673249
             RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49
                       +k++s++d+skyFslp+ dAA++Lgvc++vLK+iCR +G++RWP+Rk 
  orange1.1g023462m 26 TKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKF 73
                       799********************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.597995IPR003035RWP-RK domain
PfamPF020427.3E-212973IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MMSSLSLHNN SSISKAAASS SISTSTKSLS FDDISKYFSL PLSDAANHLG VCVSVLKKIC  60
RDNGLDRWPY RKFLSGKSIE DIKKYAAREK SKELAELSKI ARKSGFQPLS NETSKLHGVT  120
SPPNLQQQGS KNSPVGQPHV LLNANLTKGI MALDEFKHGF PSDGLSTASY KWWGGRSSDG  180
NDGIHKDESE IDEEDKQAEA KADKESATQA TGNEKSGNGE TESNVDPQGS GLLTAARKRT  240
VEEGREALKL GVYKKYCVKQ LDRKERVLLH RIFKSSLPKE WL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.61690.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0646790.0KX064679.1 Citrus trifoliata clone 2 RWP-RK domain containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437156.10.0protein NLP3
RefseqXP_006484885.10.0protein NLP3
TrEMBLA0A067FCP30.0A0A067FCP3_CITSI; Uncharacterized protein
STRINGXP_006484885.10.0(Citrus sinensis)
STRINGXP_006437156.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1165168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.18e-11RWP-RK domain-containing protein