PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004975m
Common NameCISIN_1g004975mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Nin-like
Protein Properties Length: 722aa    MW: 80035.1 Da    PI: 6.0292
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004975mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.2e-29625675252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  orange1.1g004975m 625 EKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 675
                        79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.507614695IPR003035RWP-RK domain
PfamPF020427.1E-25627675IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MDDGNFTPNP SFGAFPGTAM DLDFMDELLF DGCWLETTDA LDFLQPGPSS SGPADDTSQY  60
LPYSEGTTGH LSMNLNPQQQ VYQEETKNKF TENPSLVYPK IEEIQDTRTQ DHQGFDPATS  120
SGQSGSFLAQ GNELGRRWWI GPRENTGHSS SVKDRLMQAI IYLKDYIKDG KALVQIWVPI  180
NSGGKQLLTT DDQPYSLDPN SKSLESYRNV STTYHFAADE DSKEFVGLPG RVFREQSPEW  240
TPDVLFFRSE EYPRVNHAQQ YDVHGSLALP VFERGSGACL GVVEVVTTSR KINYRLDLEN  300
VCKALEAVDL RSSGNFSTSC VKARNELYHA AMPEIAEVLR SVCKTHKLPL ALTWAPCVQG  360
RKVECQQSDE NFPHCFLTVD SACFVANENL SGFFVACSEQ QLLQGQGIVG KAFSLSKQCF  420
TADITAFSKS NYPLSHLARM FGLRAAVAIP LRSITTGVVE FILEFFLPRE CQDIEEQKQM  480
VKSLSVAMQQ VCQSLRLAME KELEVVILPV GEMAVTSDGS SPSKETSQEQ SSWISHMIEA  540
QQKGKGVSVS WDHQEEPKEE FKMTTHWDDA RAESFHKEVF PGFGQFQHNS GAKSSVEGGG  600
DSSSLGGHLS VGSRKAGEKR RTKTEKTISL QVLRQYFAGS LKDAAKSIGV CPTTLKRICR  660
QHGITRWPSR KIKKVGHSLR KLQLVIDSVQ GAEGAIQIGS FYTTFPDLNS PIFLGVVLFH  720
Q*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0562680.0KX056268.1 Citrus trifoliata transcription factor NLP2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006486604.10.0protein NLP2 isoform X1
RefseqXP_015388283.10.0protein NLP2 isoform X1
RefseqXP_015388284.10.0protein NLP2 isoform X1
RefseqXP_024957954.10.0protein NLP2 isoform X2
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A067FXZ80.0A0A067FXZ8_CITSI; Uncharacterized protein
STRINGXP_006486601.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein