PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.124240.1 | ||||||||
Common Name | Csa_6G445000, LOC101213922 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 9852.65 Da PI: 10.52 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 132.4 | 1.2e-41 | 25 | 89 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ea+G+nPGlivllvvggll+ flvgny+ly+yaqk+lPP+kkkPvskkk+kre+lkqGv++PGe Cucsa.124240.1 25 GEARGFNPGLIVLLVVGGLLFAFLVGNYALYMYAQKTLPPKKKKPVSKKKMKRERLKQGVSAPGE 89 599*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.5E-40 | 26 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MEDDFDFGDK VPPAVNRMGN VIRDGEARGF NPGLIVLLVV GGLLFAFLVG NYALYMYAQK 60 TLPPKKKKPV SKKKMKRERL KQGVSAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681842 | 1e-107 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
GenBank | LN713259 | 1e-107 | LN713259.1 Cucumis melo genomic chromosome, chr_5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004143239.1 | 5e-58 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | P42553 | 4e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | A0A0A0KEM3 | 1e-56 | A0A0A0KEM3_CUCSA; DNA-binding protein S1FA | ||||
STRING | XP_004156305.1 | 2e-57 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.124240.1 |
Entrez Gene | 101213922 |
Publications ? help Back to Top | |||
---|---|---|---|
|