PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10019520m | ||||||||
Common Name | CARUB_v10019520mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27839.4 Da PI: 9.3976 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.7 | 4.9e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+ Carubv10019520m 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 114.4 | 1.1e-37 | 89 | 182 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 s++ea+++++qqe++kL+++i+ +q+ +Rh++Ge+L+sL++keL++Le +Lek+++++RskKne+l+++ie++qk+e +lq++n++Lr+k++e Carubv10019520m 89 PSVTEANTQYYQQEASKLRRQIRDIQNLNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNEMLVAEIEYMQKREMDLQHDNMYLRAKIAE 182 45899**************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.165 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-39 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.83E-39 | 18 | 84 | No hit | No description |
SuperFamily | SSF55455 | 4.71E-30 | 18 | 94 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.2E-26 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.8E-27 | 94 | 180 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.961 | 96 | 186 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MEEGGSSHEA DSSKKIVGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LVIFSTRGRL YEYANNRYKK ACSDAVNPPS VTEANTQYYQ QEASKLRRQI RDIQNLNRHI 120 VGESLGSLNF KELKNLEGRL EKGISRVRSK KNEMLVAEIE YMQKREMDLQ HDNMYLRAKI 180 AEGARLNPGQ QESSVIQGTT VYESGVSTHH DQSHHYNRNY IPVNLLEPNQ QFSAQDQPPL 240 QLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-19 | 17 | 76 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00093 | SELEX | Transfer from AT3G58780 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10019520m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU551770 | 0.0 | EU551770.1 Capsella bursa-pastoris SHATTERPROOF1a-like protein (SHP1a) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023637931.1 | 1e-179 | agamous-like MADS-box protein AGL1 | ||||
Swissprot | P29381 | 1e-166 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
TrEMBL | R0HQ75 | 1e-180 | R0HQ75_9BRAS; Uncharacterized protein | ||||
STRING | XP_006293200.1 | 0.0 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3341 | 23 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.2 | 1e-171 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10019520m |
Entrez Gene | 17884853 |
Publications ? help Back to Top | |||
---|---|---|---|
|