PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | augustus_masked-scaffold35799-abinit-gene-0.0-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 82aa MW: 9620.04 Da PI: 7.5066 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 54.6 | 2e-17 | 9 | 73 | 34 | 98 |
SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 + +le+ +gr+W v++ y+ +s+++ +++GW eF++ n+L egD++vF+l++r+ l augustus_masked-scaffold35799-abinit-gene-0.0-mRNA-1 9 QIAKLENFEGRQWPVNCYYKPSSSAMNMGQGWIEFARHNDLAEGDVCVFELIKRKPVVL 67 4689*************99**********************************999999 PP EEEEE- CS B3 93 vvkvfr 98 +v++fr augustus_masked-scaffold35799-abinit-gene-0.0-mRNA-1 68 NVSMFR 73 999998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.717 | 1 | 75 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 3.1E-16 | 3 | 73 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 2.16E-16 | 4 | 77 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 4.32E-16 | 4 | 73 | No hit | No description |
Pfam | PF02362 | 4.3E-15 | 7 | 73 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
FKYLHQHDQI AKLENFEGRQ WPVNCYYKPS SSAMNMGQGW IEFARHNDLA EGDVCVFELI 60 KRKPVVLNVS MFRVVDYDIP AK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4i1k_A | 1e-15 | 2 | 77 | 73 | 145 | B3 domain-containing transcription factor VRN1 |
4i1k_B | 1e-15 | 2 | 77 | 73 | 145 | B3 domain-containing transcription factor VRN1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023901678.1 | 5e-34 | B3 domain-containing transcription factor VRN1-like | ||||
TrEMBL | A0A2N9G2Y2 | 5e-27 | A0A2N9G2Y2_FAGSY; Uncharacterized protein | ||||
STRING | XP_004145349.1 | 4e-16 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14054 | 8 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49480.1 | 5e-17 | related to vernalization1 1 |