![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C018030P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 227aa MW: 25588.4 Da PI: 10.0312 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.4 | 3.2e-22 | 17 | 61 | 5 | 49 |
SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KKA+EL++LC+ae+a+i+fs+ k++ + MELO3C018030P1 17 NESNLQVTFSKRRSGLFKKASELCTLCGAEIAIIVFSPGKKVFSF 61 89************************************9999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.7E-30 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 23.549 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.42E-33 | 6 | 73 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-25 | 6 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-18 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.7E-24 | 16 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-18 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-18 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009960 | Biological Process | endosperm development | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MRKSRGRQKV EMVKMPNESN LQVTFSKRRS GLFKKASELC TLCGAEIAII VFSPGKKVFS 60 FGHPCVEALI ERFVTRNPPP SSGTLQLIEA HRNANVRELN AQLTQVLNQL EMERKRGEEL 120 NKLRKASQAQ CWWELPIEEM EMHQLEQLKA SLDELKKNVT QQADRILIQT SSNANPPTQL 180 IFPTQIPTPT TTNGPNQQPG LFVVDPKNII SHLPFNYGSY GSRGFF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3kov_B | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3kov_I | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3kov_J | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_A | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_B | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_C | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_D | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_I | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
3p57_J | 7e-16 | 6 | 84 | 1 | 79 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681874 | 0.0 | LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031. | |||
GenBank | LN713261 | 0.0 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008454428.1 | 1e-168 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 4e-68 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A1S3BYP6 | 1e-167 | A0A1S3BYP6_CUCME; agamous-like MADS-box protein AGL62 | ||||
STRING | XP_008454428.1 | 1e-167 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 3e-70 | AGAMOUS-like 62 |
Publications ? help Back to Top | |||
---|---|---|---|
|