PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011410P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 73aa    MW: 8412.82 Da    PI: 10.7762
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011410P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.65.8e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+i+fs +gklye+ss
  MELO3C011410P1  9 KKIENKINRQVTFTKRRNGLLKKAYELSILCDAEVALIVFSARGKLYEFSS 59
                    78***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.193161IPR002100Transcription factor, MADS-box
CDDcd002651.52E-37261No hitNo description
SuperFamilySSF554551.07E-30265IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MGRGRVELKK IENKINRQVT FTKRRNGLLK KAYELSILCD AEVALIVFSA RGKLYEFSSS  60
SRHVFNHFLS FY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-20161161MEF2C
5f28_B2e-20161161MEF2C
5f28_C2e-20161161MEF2C
5f28_D2e-20161161MEF2C
6byy_A2e-20161161MEF2 CHIMERA
6byy_B2e-20161161MEF2 CHIMERA
6byy_C2e-20161161MEF2 CHIMERA
6byy_D2e-20161161MEF2 CHIMERA
6bz1_A2e-20161161MEF2 CHIMERA
6bz1_B2e-20161161MEF2 CHIMERA
6bz1_C2e-20161161MEF2 CHIMERA
6bz1_D2e-20161161MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818231e-119LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132571e-119LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016899976.11e-35PREDICTED: MADS-box protein CMB1
SwissprotQ8LLR23e-33MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLA0A1S4DVG42e-34A0A1S4DVG4_CUCME; MADS-box protein CMB1
STRINGXP_008445436.18e-35(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-34MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]