![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C010678P3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 131aa MW: 15167.2 Da PI: 9.074 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.9 | 9.4e-10 | 71 | 105 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LA+ +gL+ +q+ +WF N+R ++ MELO3C010678P3 71 KWPYPTEADKVALAETTGLDPKQINNWFINQRKRH 105 569*****************************985 PP | |||||||
2 | ELK | 22.5 | 2.6e-08 | 26 | 46 | 2 | 22 |
ELK 2 LKhqLlrKYsgyLgsLkqEFs 22 LK++Ll ++g++g+Lk EFs MELO3C010678P3 26 LKDMLLSRFGGHIGTLKLEFS 46 9*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 5.3E-4 | 25 | 46 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.5E-7 | 26 | 46 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.406 | 45 | 108 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.4E-19 | 46 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 5.9E-12 | 47 | 112 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-27 | 50 | 109 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 2.2E-17 | 65 | 104 | IPR008422 | Homeobox KN domain |
CDD | cd00086 | 3.62E-11 | 71 | 109 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 83 | 106 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MSSDDELNCG ERELQDGQMR LEDKGLKDML LSRFGGHIGT LKLEFSKKKK KGKLPKEGRK 60 VLLEWWDVHY KWPYPTEADK VALAETTGLD PKQINNWFIN QRKRHWKPSE SMQFGNIDNT 120 AEQFSARLDS * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 1e-125 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 1e-125 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008444355.1 | 4e-92 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 3e-51 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A1S3BA77 | 8e-91 | A0A1S3BA77_CUCME; homeobox protein knotted-1-like 6 | ||||
STRING | XP_008444355.1 | 1e-91 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 8e-42 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|