PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla021107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 291aa    MW: 32306.1 Da    PI: 7.5069
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla021107genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.5e-19138192256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq  +Lee F+++++++ +++  LAk+l+Lt rqV vWFqNrRa+ k
  Cla021107 138 RKKLRLSKEQSMVLEETFKEHNTLNPKQKLALAKQLNLTPRQVEVWFQNRRARTK 192
                788899***********************************************98 PP

2HD-ZIP_I/II127.46e-41138227191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
    Cla021107 138 RKKLRLSKEQSMVLEETFKEHNTLNPKQKLALAKQLNLTPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELR-AL 227
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.7E-311101IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.608.3E-20121188IPR009057Homeodomain-like
SuperFamilySSF466898.36E-20124195IPR009057Homeodomain-like
PROSITE profilePS5007117.734134194IPR001356Homeobox domain
SMARTSM003895.2E-17136198IPR001356Homeobox domain
CDDcd000863.67E-16138195No hitNo description
PfamPF000461.8E-16138192IPR001356Homeobox domain
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
PfamPF021832.4E-11194228IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.7E-27194237IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGGRDDELGL SLSLGFGVTT QPSFQPTHMH RPLNNSMHNH LRKSSWNELF QFSDRNADSR  60
SFLRGIDVNR LPTGADGEEE NGVSSPNSTI SSISGKRSER EAAGDEAEAG AEAEAERASC  120
SRGSDDEDGG GGDGDASRKK LRLSKEQSMV LEETFKEHNT LNPKQKLALA KQLNLTPRQV  180
EVWFQNRRAR TKLKQTEVDC EYLKRCCENL TEENRRLQKE VQELRALKLS PQLYMHMNPP  240
TTLTMCPQCE RVAVSSSSLA SAATTTRHPA AASVQRPSMA INPWAVLPIQ R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142SRKKLRL
2186194RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1829280.0AB182928.1 Citrullus lanatus mRNA for HD-ZIP protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437820.11e-160PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP466021e-106HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A1S3AUW71e-159A0A1S3AUW7_CUCME; homeobox-leucine zipper protein HAT3-like
STRINGXP_008437820.11e-160(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.11e-72homeobox-leucine zipper protein 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]