PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 731aa    MW: 81152.2 Da    PI: 6.1843
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019400genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.4e-1961116156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                r++ +++t+ q++e+e++F+++++p+ ++r++L+++lgL+  qVk+WFqN+R++ k
  Cla019400  61 RKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELGLEPLQVKFWFQNKRTQIK 116
                789999**********************************************9877 PP

2START1853.9e-582534721206
                HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
      START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                ela +a++e+ ++a+a+ep+Wv+     e++n+de+l++ +++ +      s ea+r + ++  ++ +lv  l+d++ qW++ +     +a tlev+s+g
  Cla019400 253 ELAVSAMEEVCRMAQAGEPLWVTGEnsmEMLNEDEYLRTYSTQIGprivgLSFEASRQTSILAFNHLKLVHVLMDVN-QWSTIFCgivsRALTLEVLSTG 351
                57899******************99999************99999********************************.******99999*********** PP

                ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHH CS
      START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwll 181
                      gal++m+ae+q++splvp R+ +fvRy++q+ + +w++vdvS+d  ++ p+     R +++pSg+li++++ng skvtwvehv++++r +h+l+
  Cla019400 352 vggdynGALHVMTAEFQVPSPLVPtRENYFVRYCKQQADRSWAVVDVSLDYLRPTPT----SRTRRRPSGCLIQELPNGCSKVTWVEHVEVDDRAVHNLY 447
                ******************************************************995....78889********************************** PP

                HHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 182 rslvksglaegaktwvatlqrqcek 206
                +++v+ gla+gak+w+atl+rqc++
  Cla019400 448 KRVVSCGLAFGAKRWMATLDRQCQR 472
                ***********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-1947119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-2156116IPR009057Homeodomain-like
PROSITE profilePS5007116.7358118IPR001356Homeobox domain
SMARTSM003891.1E-1759122IPR001356Homeobox domain
CDDcd000861.98E-1860119No hitNo description
PfamPF000466.2E-1761116IPR001356Homeobox domain
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
SuperFamilySSF559612.61E-32244473No hitNo description
PROSITE profilePS5084842.907244475IPR002913START domain
CDDcd088751.48E-108248471No hitNo description
SMARTSM002343.6E-56253472IPR002913START domain
PfamPF018521.1E-48254472IPR002913START domain
Gene3DG3DSA:3.30.530.202.0E-4357464IPR023393START-like domain
SuperFamilySSF559612.54E-20495721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MFGAHGFEDH HEDLLLEMTQ KNFECELEKF GEDEFESRSV TDAMEAPLGE ELCVLNQRNK  60
RKRYHRHTQL QIQEMEAFFK ECPHPDDKQR KQLSRELGLE PLQVKFWFQN KRTQIKAQQE  120
RHENAILKAQ NEKLRAENMR YKEALSNTSC PNCGGPAALG EMSFDAQHLR IDNAHLRDEI  180
ERLNSSSKYG GKAWGSHSHM VPCGGQLDHL GVGRSSLKPQ QADHLLGEMY GGVGETMLKK  240
SVTTEIDKPV IVELAVSAME EVCRMAQAGE PLWVTGENSM EMLNEDEYLR TYSTQIGPRI  300
VGLSFEASRQ TSILAFNHLK LVHVLMDVNQ WSTIFCGIVS RALTLEVLST GVGGDYNGAL  360
HVMTAEFQVP SPLVPTRENY FVRYCKQQAD RSWAVVDVSL DYLRPTPTSR TRRRPSGCLI  420
QELPNGCSKV TWVEHVEVDD RAVHNLYKRV VSCGLAFGAK RWMATLDRQC QRLTNSSSTN  480
IAALDICGEE EKSVMKLAER MVRSFCSGVG AATAHNWTTL STIDSDNVRV MARKSLDDPG  540
RPPGIVLNAA TSFWIPIPPN RVFHFLRDQN TRNQWDILSN GGLVQEMARI GNDRNPGNCV  600
SLLRSANSSQ SNMLILQESC SDDISGSYII YAPVDTVAMN MVLSGGDPDY VALLPSGFAI  660
LPDGPPIGAD GPSGILEFGS GGSLLTVAFQ ILVDSAPTAK LSLGSVATVN SLIKCTVERI  720
RAALMCDQPM N
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-133LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-133LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441375.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A1S3B3970.0A0A1S3B397_CUCME; homeobox-leucine zipper protein PROTODERMAL FACTOR 2
STRINGXP_008441375.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2480333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]