PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 220aa    MW: 25182.4 Da    PI: 8.8819
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014193genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-1963116457
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                ++++++eq++ Le  F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  Cla014193  63 KRKLSSEQVKLLEINFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 116
                56899***********************************************95 PP

2HD-ZIP_I/II117.19.8e-3862153293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkr+ls+eqvklLE +F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+a+d++  +n++Le+e  +++e+lke
    Cla014193  62 KKRKLSSEQVKLLEINFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKLEEEYSTLKKAHDSVLLQNSHLESELVKVKEQLKE 153
                  9****************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.47157117IPR001356Homeobox domain
SMARTSM003897.6E-1860121IPR001356Homeobox domain
SuperFamilySSF466896.68E-1862126IPR009057Homeodomain-like
PfamPF000462.1E-1663116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-2064124IPR009057Homeodomain-like
CDDcd000861.17E-1464118No hitNo description
PRINTSPR000311.4E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000311.4E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAAMNLRPDG DNSQLISHLY NPEIYTQMLP QQGTAEGNKP PKRRRRRSKA KEGGGAGAAG  60
LKKRKLSSEQ VKLLEINFGN EHKLESERKD RLASELGLDP RQVAVWFQNR RARWKNKKLE  120
EEYSTLKKAH DSVLLQNSHL ESELVKVKEQ LKEAKNEIKK LGEGSERISS NNSPSSSVTM  180
EAVEAVPLGE LFLEEYEDVF YCMQDNNYNQ GMDWLNLNYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14146KRRRRR
24464RRRSKAKEGGGAGAAGLKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-133LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-133LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143500.11e-123PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU705e-64ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A0A0KGE81e-122A0A0A0KGE8_CUCSA; Uncharacterized protein
STRINGXP_004143500.11e-123(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-49homeobox protein 40
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]