PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 710aa    MW: 79039 Da    PI: 6.688
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013146genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-192883156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ ++++++q+++Le++F+ +++p++++r++L+++lgL+++q+k+WFqN+R++ k
  Cla013146 28 KKTYHRHNPYQIQQLESFFRACPHPDENQRRQLSQELGLETKQIKFWFQNKRTQTK 83
               688999**********************************************9987 PP

2START136.13.9e-432274473206
                HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
      START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                a +a++el+++   +ep+W+k    ++g +vl +++ +k             ++e ++asgvv+m + +lv  +ld   +W   ++     a+t   i++
  Cla013146 227 AATALEELIRLLRIDEPLWMKTL--NDGRYVLHRESYDKIfprpnhfksssARTESSKASGVVTMSAIQLVDFFLDAD-KWADLFPtiimNADTFHIIDP 323
                67899******************..888888888877777788888999999*******************9999999.******99999********** PP

                T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HH CS
      START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp.hw 179
                g      galqlm++++   splv+ Rdf f+R+++q + g+wvivdvS +  ++  +   ++R+ +lpSg+li++++ng sk+twvehv++++++  h 
  Cla013146 324 GmpgnrsGALQLMYQQMHIFSPLVSpRDFCFLRHCQQIELGVWVIVDVSYEILKDCVT---SARCWRLPSGCLIQEMPNGCSKITWVEHVEVDDKTQtHR 420
                **********************9999************************98888775...8********************************9998** PP

                HHHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 180 llrslvksglaegaktwvatlqrqcek 206
                l+r lv ++la ga +w+ tlqr ce+
  Cla013146 421 LYRDLVFNTLAYGADRWFFTLQRMCER 447
                *************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-201379IPR009057Homeodomain-like
SuperFamilySSF466898.36E-191486IPR009057Homeodomain-like
PROSITE profilePS5007116.5682585IPR001356Homeobox domain
SMARTSM003891.6E-162789IPR001356Homeobox domain
PfamPF000465.8E-172883IPR001356Homeobox domain
CDDcd000861.40E-162886No hitNo description
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PROSITE profilePS5084844.133216450IPR002913START domain
SuperFamilySSF559611.02E-32218449No hitNo description
CDDcd088751.41E-104221446No hitNo description
SMARTSM002341.6E-30225447IPR002913START domain
PfamPF018523.4E-36227447IPR002913START domain
Gene3DG3DSA:3.30.530.202.4E-10270411IPR023393START-like domain
SuperFamilySSF559611.07E-12468642No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MDYMMDGRGG YGGGSTDEQE GSNDRKGKKT YHRHNPYQIQ QLESFFRACP HPDENQRRQL  60
SQELGLETKQ IKFWFQNKRT QTKAQNERAD NSSLRTENEK IQCENLAIRE ALRNVICPSC  120
GGPPFGEEER QRNLQKLRLE NSHLKEEHDK VSNLLAKYIG KPISQLESLL PVLGSSIDLS  180
PRSSLTQIVA SPAVDLISDP VILDGAATPY QSRGINDLEN ALMLETAATA LEELIRLLRI  240
DEPLWMKTLN DGRYVLHRES YDKIFPRPNH FKSSSARTES SKASGVVTMS AIQLVDFFLD  300
ADKWADLFPT IIMNADTFHI IDPGMPGNRS GALQLMYQQM HIFSPLVSPR DFCFLRHCQQ  360
IELGVWVIVD VSYEILKDCV TSARCWRLPS GCLIQEMPNG CSKITWVEHV EVDDKTQTHR  420
LYRDLVFNTL AYGADRWFFT LQRMCERLAY TFRDCAPSHE LGGVLTSPEG RRSITKLSHR  480
MVKNFCGVLS MSGKLDFPQL SEVNNSGVRI SVRISSELGQ PSGTVVSAAT SLWLPLQPEI  540
IFNFFRDEKA RVQWDVLSYG NPVHEIAHIL TGVHPGNSIS IIRPFVPTEN NMLILQESCI  600
DPLGSLVIYA PIDLPAMNIA TSGQDPSGIP ILPSGFVITG DGRMHSGIGA STSATSGRPS  660
GSLLTIAFQI LVSSVSSSKQ LNVESVATVN TLISATVQRI KAALNCSGLD
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:18451323, ECO:0000269|PubMed:23095885, ECO:0000269|PubMed:24821957, ECO:0000269|PubMed:24824485, ECO:0000269|PubMed:25564655, ECO:0000269|PubMed:25752924}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818540.0LN681854.1 Cucumis melo genomic scaffold, anchoredscaffold00042.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140733.20.0PREDICTED: homeobox-leucine zipper protein HDG11 isoform X2
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0A0L6560.0A0A0A0L656_CUCSA; Uncharacterized protein
STRINGXP_004140733.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  3. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]
  4. Cai XT,Xu P,Wang Y,Xiang CB
    Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis.
    J Integr Plant Biol, 2015. 57(12): p. 1017-30
    [PMID:25752924]
  5. Yu LH, et al.
    Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field.
    Plant Biotechnol. J., 2016. 14(1): p. 72-84
    [PMID:25879154]
  6. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  7. Liu Y, et al.
    Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza.
    Protoplasma, 2017. 254(4): p. 1617-1625
    [PMID:27915455]
  8. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  9. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  10. Zheng G, et al.
    Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.).
    Front Plant Sci, 2017. 8: p. 2125
    [PMID:29326737]