PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla012849
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CAMTA
Protein Properties Length: 1098aa    MW: 122453 Da    PI: 5.4915
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla012849genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1182.93.5e-57161322118
       CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywl 101
                ++ k+rwl++ ei++iL n++k+++t+e+++rp+sgsl+L++rk++ryfrkDG++w+kkkdgktvrE+hekLKvg+++vl+cyYah+een++fqrr+yw+
  Cla012849  16 IEAKHRWLRPAEICEILRNYSKFRITSEPPDRPSSGSLFLFDRKVLRYFRKDGHKWRKKKDGKTVREAHEKLKVGSIDVLHCYYAHGEENENFQRRSYWM 115
                4569************************************************************************************************ PP

       CG-1 102 Leeelekivlvhylevk 118
                Lee+l +iv+vhylevk
  Cla012849 116 LEEHLMHIVFVHYLEVK 132
                **************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.75611137IPR005559CG-1 DNA-binding domain
SMARTSM010766.0E-8114132IPR005559CG-1 DNA-binding domain
PfamPF038591.3E-5017131IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.109.9E-8486588IPR013783Immunoglobulin-like fold
PfamPF018332.8E-5502575IPR002909IPT domain
SuperFamilySSF812965.29E-16503587IPR014756Immunoglobulin E-set
SuperFamilySSF484037.15E-16683800IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-15685801IPR020683Ankyrin repeat-containing domain
CDDcd002041.28E-12688798No hitNo description
PROSITE profilePS5029717.688688810IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.549738771IPR002110Ankyrin repeat
SuperFamilySSF525403.19E-8920971IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.0099920942IPR000048IQ motif, EF-hand binding site
PfamPF006125.9E-4922941IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.261922950IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0038943965IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.633944968IPR000048IQ motif, EF-hand binding site
PfamPF006122.3E-4946965IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1098 aa     Download sequence    Send to blast
MADTAYILAD IEQLLIEAKH RWLRPAEICE ILRNYSKFRI TSEPPDRPSS GSLFLFDRKV  60
LRYFRKDGHK WRKKKDGKTV REAHEKLKVG SIDVLHCYYA HGEENENFQR RSYWMLEEHL  120
MHIVFVHYLE VKGNRTNAGA VVETDEVSSS SQKSSPRSSS YSSSHNQAAS ENADSPSPTS  180
TLTSFCEDAD AEDTYQATSR FHSFPTLPKM GNGLLVNKQD ADQSKFYFPH SSSNNLDAWS  240
SGPSVDYVTQ VQKAGLGSND GDTGVMGSQK TLSSASWEEI LQQCTTGFQT VPSHVLTSSI  300
EPLSSGIVLG QENSIPSKLL TSNSAIKEDF GSSLTMTSNW QVPFEDNTLS FSKEHADQYP  360
DLYSVYDIDS RFEQKSHDST FGSGHEMFSA HPGIENEDIL PNLELQFKEG ELYSAMRLSS  420
ENDMSKEGTI SYSLTLKQSL IDGEESLKKV DSFSRWVSKE LGEVDDLHMH PSSGLSWTTV  480
ECGDMVDDSS LSPSISEDQL FSITAFSPKW TLADLETEVV IIGKFLGNNH GTNCHWSCMF  540
GEVEVPAEVL ADGILCCHAP PHSVGRVPFY VTCSNRVACS EVREFDYLAG SAQDVDVTDI  600
YTVGSTKELC MHLRLERLLS LGSLDPSNDL SEDALEKRNL IRELITIKEE EDLYGEEPNS  660
QNDQIQHQNK DKEFLFVKLM KEKLYSWLIH KVIEGGKGPN ILDGDGQGVI HLAAALGYDW  720
AIRPIVAAGV SINFRDINGW TAVHWAASCG RQELTVGTLM SLDADPGLPS DPSPEFPWGR  780
TPADLASDNG HKGISGFLAE AALTSYVKSV SMADSISMGE AVEDGVADVS KRKPVHTVSE  840
RRATPVNDGF MPGDLSLKDS LTAVCNATQA AGRIHLMFRM QSFQRKKLSE CGTDEFGSSD  900
DSALSFVKAR ARKSGLSNSP VHAAAVQIQK KFRGWRMRKE FLLIRQRIVK IQAHVRGHQV  960
RKQYKKIVWS VGMIDKIILR WRRKGSGLRG FRADAVAKDP PSVMAPPTKE DDYDFLKEGR  1020
RQTEERFQKA LTRVKSMAQY PEGRDQYRRL LTVVQKCRET KGSHMAVTST SEEIIEGDDM  1080
IDIDTLLDDD ALMSMTFD
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455205.10.0PREDICTED: calmodulin-binding transcription activator 2 isoform X2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A1S3C1370.0A0A1S3C137_CUCME; calmodulin-binding transcription activator 2 isoform X2
STRINGXP_008455204.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74062642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains
Publications ? help Back to Top
  1. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  2. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]