PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 254aa    MW: 29228.5 Da    PI: 4.7988
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010153genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.7e-183891356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k++++t +q++ Le+ F+ ++++ ++++ ++A+++gL  rqV vWFqNrRa+ k
  Cla010153 38 KKRRLTVDQVRLLEKNFNDENKLEHDRKVQIAEEIGLRPRQVAVWFQNRRARSK 91
               45689***********************************************99 PP

2HD-ZIP_I/II118.24.7e-3838129293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  kkrrl+ +qv+lLE++F+ e+kLe++rKv++a+e+gl+prqvavWFqnrRAR ktk++Ekdye+L ++yd+lk++ ++L k ++eL++e+++
    Cla010153  38 KKRRLTVDQVRLLEKNFNDENKLEHDRKVQIAEEIGLRPRQVAVWFQNRRARSKTKRIEKDYESLNAEYDKLKNDFDSLLKLNQELKAEVDQ 129
                  9**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-171893IPR009057Homeodomain-like
PROSITE profilePS5007116.5363393IPR001356Homeobox domain
SMARTSM003892.3E-163697IPR001356Homeobox domain
PfamPF000461.7E-153891IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-173891IPR009057Homeodomain-like
CDDcd000861.27E-133894No hitNo description
PRINTSPR000313.2E-56473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000313.2E-57389IPR000047Helix-turn-helix motif
PfamPF021835.2E-1393133IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.142.103.7E-497213IPR004102Poly(ADP-ribose) polymerase, regulatory domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006471Biological Processprotein ADP-ribosylation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003950Molecular FunctionNAD+ ADP-ribosyltransferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDSETTRFLA KAEASSLPCF WVPDSCCSMK GEGNQGGKKR RLTVDQVRLL EKNFNDENKL  60
EHDRKVQIAE EIGLRPRQVA VWFQNRRARS KTKRIEKDYE SLNAEYDKLK NDFDSLLKLN  120
QELKAEVDQL REKWVASEKM KNPFESVGVE AMDSSVTELG KANTKTMVEI LYKVQKESSR  180
QEEGSRSSSK SDGFYSESPA RENQSKSGNF LQDEEDELGY LGKLEDELSA NELMDSFNTF  240
SSIVENQSFC FWSY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-121LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-121LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135200.11e-151PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLA0A0A0KVU61e-150A0A0A0KVU6_CUCSA; Homeobox protein
STRINGXP_004155327.11e-151(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2461633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-34homeobox protein 6