PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 747aa    MW: 81254.1 Da    PI: 6.1233
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007677genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1983138156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ +++t++q++++e++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R+++k
  Cla007677  83 KKRYHRHTQHQIQQMEAFFKECPHPDDKQRKELSRELNLEPLQVKFWFQNKRTQMK 138
                688999***********************************************999 PP

2START218.62.1e-682714911206
                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                ela +a++elv++a+ +ep+W++        +n++e++++f+++ +     +s ea+ra++vv+m++  lve l+d++ qW++ +     +a+tlev+s+
  Cla007677 271 ELAVAAMEELVRMAQMGEPLWMTGLdgstAVLNEEEYVRSFPRGIGpkpsgFSCEASRATAVVIMNHISLVEMLMDVN-QWSTIFSgivsRAMTLEVLST 369
                57899******************999988899***********999********************************.********************* PP

                T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHH CS
      START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwl 180
                g      galq+m++elq++splvp R+++fvRy++q+g+g+w++vdvS+d+ ++ p      R++++pSg+li++++ng+skvtwvehv++++r +h+l
  Cla007677 370 GvagnynGALQVMTSELQVPSPLVPtRESYFVRYCKQHGEGTWAVVDVSLDNLRPAPA----LRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHSL 465
                *******************************************************995....************************************** PP

                HHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 181 lrslvksglaegaktwvatlqrqcek 206
                +++lv+sg+a+ga++w atl+rqce+
  Cla007677 466 YNQLVRSGHAFGARRWIATLDRQCER 491
                ************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2160138IPR009057Homeodomain-like
SuperFamilySSF466893.51E-1967139IPR009057Homeodomain-like
PROSITE profilePS5007116.56880140IPR001356Homeobox domain
SMARTSM003898.4E-1981144IPR001356Homeobox domain
CDDcd000867.66E-1983141No hitNo description
PfamPF000462.8E-1783138IPR001356Homeobox domain
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PROSITE profilePS5084845.578262494IPR002913START domain
SuperFamilySSF559611.13E-34264493No hitNo description
CDDcd088752.56E-129266490No hitNo description
SMARTSM002342.3E-62271491IPR002913START domain
PfamPF018521.3E-57272491IPR002913START domain
Gene3DG3DSA:3.30.530.202.4E-5324472IPR023393START-like domain
SuperFamilySSF559611.36E-11510739No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MPAGMMIPAR NTASSMIGRN GSVGMFGSPG SLVLGQEIQG VEMGENEYGR MRETEEFESG  60
TKSSSENHEV GSGDDQLNQR PKKKRYHRHT QHQIQQMEAF FKECPHPDDK QRKELSRELN  120
LEPLQVKFWF QNKRTQMKTH HERHENTQLR TENEKLRADN MRYREALSNA TCPNCGGPTA  180
IGEMSFDEHH LRLENARLRE EIDRISAIAA KYVGKPVSNY PLLSTPIPSR PLELGMGGYG  240
GHDSGGDMYG AADLLRTISA PSEADKPIII ELAVAAMEEL VRMAQMGEPL WMTGLDGSTA  300
VLNEEEYVRS FPRGIGPKPS GFSCEASRAT AVVIMNHISL VEMLMDVNQW STIFSGIVSR  360
AMTLEVLSTG VAGNYNGALQ VMTSELQVPS PLVPTRESYF VRYCKQHGEG TWAVVDVSLD  420
NLRPAPALRC RRRPSGCLIQ EMPNGYSKVT WVEHVEVDDR GVHSLYNQLV RSGHAFGARR  480
WIATLDRQCE RLASAMATSI PTGDAGVITN QEGRKSMLKL AERMVMSFCG GVSASTTHTW  540
TTLSGTGADD VRVMTRKSAD LPALSSAPPL PFGFLFLPTE SSIFSEMKIL WDILSNGGVV  600
QEMAHIANGR DTGNCVSLLR VNSANSSQSN MLILQESSTD QTASFVIYAP VDIVSINVVL  660
NGGDPDYVAL LPSGFAILPD GTTASSGGAA NGVAEHGSAG SLLTVAFQIL VDSVPTAKLS  720
LGSVATVNNL IACTVERIKA SLSCDNP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817921e-135LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132551e-135LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455423.10.0PREDICTED: homeobox-leucine zipper protein HDG2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A1S3C1110.0A0A1S3C111_CUCME; homeobox-leucine zipper protein HDG2
STRINGXP_008455423.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2