PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31111 Da    PI: 7.8325
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005620genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-20114168256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tk+q  +Lee F+++++++ +++  LAk+lgLt rqV vWFqNrRa+ k
  Cla005620 114 RKKLRLTKDQSAVLEESFKEHNTLNPKQKLALAKQLGLTPRQVEVWFQNRRARTK 168
                78889************************************************98 PP

2HD-ZIP_I/II129.91e-41114203191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+k+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
    Cla005620 114 RKKLRLTKDQSAVLEESFKEHNTLNPKQKLALAKQLGLTPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 203
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046187.2E-21288IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.21E-19103171IPR009057Homeodomain-like
PROSITE profilePS5007117.912110170IPR001356Homeobox domain
SMARTSM003892.2E-18112174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-19114168IPR009057Homeodomain-like
CDDcd000861.03E-17114171No hitNo description
PfamPF000462.5E-17114168IPR001356Homeobox domain
PRINTSPR000315.5E-6141150IPR000047Helix-turn-helix motif
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PRINTSPR000315.5E-6150166IPR000047Helix-turn-helix motif
SMARTSM003402.6E-27170213IPR003106Leucine zipper, homeobox-associated
PfamPF021832.1E-11170204IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMAGKDDNLG LSLGLSFDSH HLQLNLMPSS WNNDASSDRT SETGRSLLRG IDVNRMPPSS  60
TADCEEEAAM SSPNSTVSSV SGKRSEREMN GEDLDGDRAC SRGISDEEDG ETSRKKLRLT  120
KDQSAVLEES FKEHNTLNPK QKLALAKQLG LTPRQVEVWF QNRRARTKLK QTEVDCEFLK  180
RCCENLTEEN RRLQKEVQEL RALKLSPQFY MHMTPPTTLT MCPSCERVAV PPSTSAQPTH  240
VTRIGQAQPQ AHHARPIHIN PWASAIPARP FNALHPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118SRKKLRL
2162170RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818601e-117LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132601e-117LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022923548.10.0homeobox-leucine zipper protein HAT4
SwissprotP466011e-104HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A1S3BJZ91e-176A0A1S3BJZ9_CUCME; homeobox-leucine zipper protein HAT4
STRINGXP_008448815.11e-176(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-97homeobox protein 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]