PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla004833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CAMTA
Protein Properties Length: 914aa    MW: 103827 Da    PI: 6.938
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla004833genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1126.31.3e-394713034118
       CG-1  34 pksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                   gsl+Ly+rk+vryfrkDG++w+kkk gk+v+E+he+LK g+v vl+cyYah+een++fqrr+yw+Lee+l++ivlvhy+ev+
  Cla004833  47 LIGGSLFLYDRKVVRYFRKDGHNWRKKK-GKAVKEAHERLKAGSVYVLNCYYAHGEENENFQRRTYWMLEEDLSNIVLVHYREVQ 130
                5679********************9887.9****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010762.6E-4219130IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143750.72822135IPR005559CG-1 DNA-binding domain
PfamPF038591.6E-3248128IPR005559CG-1 DNA-binding domain
SuperFamilySSF812961.56E-16335421IPR014756Immunoglobulin E-set
CDDcd002045.43E-13515627No hitNo description
SuperFamilySSF484031.71E-17521629IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.2E-16526633IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.149535629IPR020683Ankyrin repeat-containing domain
PfamPF127961.9E-8540630IPR020683Ankyrin repeat-containing domain
SMARTSM002480.0051568597IPR002110Ankyrin repeat
PROSITE profilePS500889.297568600IPR002110Ankyrin repeat
SMARTSM00248170607636IPR002110Ankyrin repeat
SMARTSM0001513738760IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.92E-6739789IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500966.815739768IPR000048IQ motif, EF-hand binding site
PfamPF006120.081740759IPR000048IQ motif, EF-hand binding site
SMARTSM000150.02761783IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.212763786IPR000048IQ motif, EF-hand binding site
PfamPF006120.0022764783IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 914 aa     Download sequence    Send to blast
MVELHHSMEW RLTFRPALMP DASRLEGLAD KFHNSLSRLS NISFAKLIGG SLFLYDRKVV  60
RYFRKDGHNW RKKKGKAVKE AHERLKAGSV YVLNCYYAHG EENENFQRRT YWMLEEDLSN  120
IVLVHYREVQ ISRGNFNRNR GTDEAALFSR EFEDTKNHPE MGASNSSSFH PSNYKMLSKT  180
AETSLNSAQV SEYEDAESEY GNRESTVFHS FLGLQQLKME SNSADLCDSK YPISLSETQN  240
DQSMQEYLQK MLPNTKRECY LHLISDGKVI LEGKSNFAKK QPLLDAITTE SLRMGDSFNQ  300
WMSRELGDVK EASMQSNSGT YWNSVENDVG QLFHIIDFSP SWAYEGSEIK VLVSGKFLKS  360
PHEVENLKWC CMFGEVEVPA DVIADGVLRC FTPIHKAGKV PFYVTRSNRL ACSEVRDFEY  420
RVKCIQDVDV MYDHSIKNQA LVLRFVKLIC LSCSDTLIAD PNSSSDRSDY NKIRKLLEVD  480
NSEWDQLIKP RWDESVSLES AKELLLQRLL KEKLHVWLLQ KVREGGRGPS VLDEQGQGVI  540
HFAAALNYDW ALLPALVAGI NVNFRDANGW TALHWAAFFG RERTVAALIS LGAAPGALAD  600
PSLKYPSGRT PADLASSNGH KGIAGYLAES VLSAHLESLN FDNQESKAAD TCGEKAVQTA  660
AERVPTPHEG NDMYTLSLKD SLAAISNATQ AAARIHEVMR VQSFQRKQLE VNDKFDVSND  720
QAFSLLPVKR RNPGSHDDEH AAAIHIQNKF RSWKGRKDFL IVRQRIVKIQ AHARGHQVRN  780
NYRKILWSVG ILEKVILRWR RKGSGLRGFR PEATAEDCSR QNTSLTEDDD DFLKQGRKQI  840
EERLQKALAR VKSMVQYPEA RDQYRRLLNV VMEMQDIKVK DGVLDNVDET DDFDDLIDIK  900
ALLDEDASTP TASV
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:18298954, ECO:0000269|PubMed:19122675, ECO:0000269|PubMed:19270186, ECO:0000269|PubMed:21900483, ECO:0000269|PubMed:22345509, ECO:0000269|PubMed:22371088, ECO:0000269|PubMed:23072934, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25157030, ECO:0000269|PubMed:28351986, ECO:0000269|PubMed:28407487, ECO:0000305|PubMed:11925432}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:22345509}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022984175.10.0calmodulin-binding transcription activator 3 isoform X3
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLM5W6N00.0M5W6N0_PRUPE; Uncharacterized protein
STRINGEMJ093740.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.30.0ethylene induced calmodulin binding protein
Publications ? help Back to Top
  1. Zhang L,Du L,Shen C,Yang Y,Poovaiah BW
    Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling.
    Plant J., 2014. 78(2): p. 269-81
    [PMID:24528504]
  2. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  3. Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ
    Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae.
    Front Plant Sci, 2016. 7: p. 177
    [PMID:26973658]
  4. Benn G, et al.
    Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60
    [PMID:27432993]
  5. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  6. Lolle S, et al.
    Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.
    Cell Host Microbe, 2017. 21(4): p. 518-529.e4
    [PMID:28407487]
  7. Kim YS, et al.
    CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection.
    Plant Cell, 2017. 29(10): p. 2465-2477
    [PMID:28982964]
  8. Jacob F, et al.
    A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana.
    New Phytol., 2018. 217(4): p. 1667-1680
    [PMID:29226970]