PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla004263
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Nin-like
Protein Properties Length: 230aa    MW: 27416.5 Da    PI: 9.5248
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla004263genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.44.4e-26116163552
     RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                + le+++k+F+ pi +AAk+++v+lTvLKr+CRq++I+RWPhRk+ksl
  Cla004263 116 LGLEEIQKHFHIPISEAAKQMNVGLTVLKRRCRQLNIMRWPHRKLKSL 163
                789*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.31499185IPR003035RWP-RK domain
PfamPF020423.1E-24116163IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MESNTKLNPQ SLQNPLDFDW LQELFPFHNG LEELPPLDED GLLDFNSHSL PFHWDNNILE  60
LETEIWTRMI KLKDDERGIR EMIERPEFSS SWKEEEEEKK LRLLRNGRKR KSSSVLGLEE  120
IQKHFHIPIS EAAKQMNVGL TVLKRRCRQL NIMRWPHRKL KSLNSLIQNV KEMGLTNEVK  180
GLEEHKRLME ELPDLDLTHT TKRLRQACFK ANYKKKRRII RSNNIATLHH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198109KKLRLLRNGRKR
2213217KKKRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818502e-59LN681850.1 Cucumis melo genomic scaffold, anchoredscaffold01597.
GenBankLN7132602e-59LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466842.13e-95PREDICTED: protein RKD4
TrEMBLA0A1S3CS478e-94A0A1S3CS47_CUCME; protein RKD4
TrEMBLE5GBA68e-94E5GBA6_CUCME; Transcription factor
STRINGXP_008466842.11e-94(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.18e-42RWP-RK domain-containing protein