PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla003908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 221aa    MW: 25042.8 Da    PI: 9.9106
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla003908genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-1971125256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q + Lee F+ n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  Cla003908  71 RKKLRLSKDQSRLLEESFRLNHTLNPKQKEALAMELKLKPRQVEVWFQNRRARSK 125
                788899***********************************************98 PP

2HD-ZIP_I/II117.57.3e-3871160191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q++lLEesF+ +++L+p++K++la eL+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++e e+Lr ++
    Cla003908  71 RKKLRLSKDQSRLLEESFRLNHTLNPKQKEALAMELKLKPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNHRLQRELEALR-AI 160
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-1855121IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1959128IPR009057Homeodomain-like
PROSITE profilePS5007117.26567127IPR001356Homeobox domain
SMARTSM003892.1E-1769131IPR001356Homeobox domain
CDDcd000861.20E-1570128No hitNo description
PfamPF000461.5E-1671125IPR001356Homeobox domain
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PfamPF021831.3E-8127160IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.0E-18127170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAVFPINSSN LDLSISMPGF ASSSTRPPLM RELDMNRVPT RGEAEEEWAV APSAEEEEEE  60
SCINNGGTKP RKKLRLSKDQ SRLLEESFRL NHTLNPKQKE ALAMELKLKP RQVEVWFQNR  120
RARSKLKQTE MECEYLKRWF GSLTEQNHRL QRELEALRAI KVAPSAIVSC HDRQPPLSTS  180
TITMCPRCER ITSSKAAIAA ATKPSKVVTS TLKLHQPSRA C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16874KPRKKLR
2119127RRARSKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818955e-38LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132635e-38LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011655468.11e-110PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ8S9N67e-74ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLA0A1S3CSV71e-107A0A1S3CSV7_CUCME; homeobox-leucine zipper protein HOX3-like
STRINGXP_008467159.11e-107(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.17e-71homeobox-leucine zipper protein 17
Publications ? help Back to Top
  1. Zhao P, et al.
    ATHB17 enhances stress tolerance by coordinating photosynthesis associated nuclear gene and ATSIG5 expression in response to abiotic stress.
    Sci Rep, 2017. 7: p. 45492
    [PMID:28358040]