PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla003103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 330aa    MW: 37342.1 Da    PI: 4.5177
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla003103genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.3e-1962115356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Cla003103  62 KKRRLSVEQVKALEKNFEVENKLEPERKVKLARELGLQPRQVAVWFQNRRARWK 115
                56689************************************************9 PP

2HD-ZIP_I/II128.82.2e-4161153193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls eqvk+LE++Fe e+kLeperKv+lareLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y++lk + e+L++++++L ++++e
    Cla003103  61 EKKRRLSVEQVKALEKNFEVENKLEPERKVKLARELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKTNYENLKLSYETLQNDNQALLKQIRE 153
                  69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.21E-1947119IPR009057Homeodomain-like
PROSITE profilePS5007117.55657117IPR001356Homeobox domain
SMARTSM003891.0E-1760121IPR001356Homeobox domain
PfamPF000465.6E-1662115IPR001356Homeobox domain
CDDcd000862.33E-1662118No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2064124IPR009057Homeodomain-like
PRINTSPR000311.1E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000311.1E-597113IPR000047Helix-turn-helix motif
PfamPF021835.1E-16117159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MKRPAVSSDS LGALISICPT SDHEQSPRNK NSNHVYGTEF QSMLDGFEEE GCVEESGHVS  60
EKKRRLSVEQ VKALEKNFEV ENKLEPERKV KLARELGLQP RQVAVWFQNR RARWKTKQLE  120
RDYGVLKTNY ENLKLSYETL QNDNQALLKQ IRELKSKLQE DNSESNLSVE EEMVVATDSE  180
NALIEQTKPE IGDQFSVPPA SESQDFNHES FNNNGGEGEE AAIEEVSLFA DFKDGSSDSD  240
SSAILNEDYS PTAGISSPGV LQNHQQYHFM TGAVSPAPSA AVKLNYLQFQ KGYQQQTQMF  300
PKMEEHNFFS GEEACNFFSD EQAPTLHWWG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023547219.10.0homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A0A0KGQ31e-134A0A0A0KGQ3_CUCSA; Uncharacterized protein
STRINGXP_004143453.11e-135(Cucumis sativus)
STRINGXP_004173863.11e-135(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-73homeobox protein 6