PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0542s0040.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 195aa MW: 22540 Da PI: 8.8779 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.6 | 1.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskR++g+lKKA+ELSvLCda+va i+fs++gkly+++s Cagra.0542s0040.1.p 9 KRIENLTSRQVTFSKRKKGLLKKAHELSVLCDAQVAAIVFSQKGKLYDFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 51.8 | 3.6e-18 | 83 | 166 | 9 | 92 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 + e+ + l++e++ + ++i+ Lq R+l+G+dL+s s+ eL+++ qLeksl+ +Rs+K +l +++e+l + ++l++e+ Cagra.0542s0040.1.p 83 QREKYVQDLKKEISVMVNRIDLLQLHCRKLMGQDLDSSSVDELKEITIQLEKSLTIVRSRKAKLNEDEVEKLEEESRSLDNEKS 166 56788999****************999***************************************************999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.992 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.53E-37 | 2 | 68 | No hit | No description |
SuperFamily | SSF55455 | 3.27E-30 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.6E-17 | 87 | 166 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.786 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MARKKIEIKR IENLTSRQVT FSKRKKGLLK KAHELSVLCD AQVAAIVFSQ KGKLYDFASS 60 NMEKMMERCE IYRREYFSAE RFQREKYVQD LKKEISVMVN RIDLLQLHCR KLMGQDLDSS 120 SVDELKEITI QLEKSLTIVR SRKAKLNEDE VEKLEEESRS LDNEKSAASC GYGNMNTSDV 180 ETDLFIGLPQ SRML* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 9e-20 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_B | 9e-20 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_C | 9e-20 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_D | 9e-20 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0542s0040.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006281451.1 | 1e-125 | MADS-box protein AGL71 | ||||
Swissprot | Q9LT93 | 6e-74 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | R0GCF9 | 1e-124 | R0GCF9_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.0542s0040.1.p | 1e-139 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.1 | 6e-72 | AGAMOUS-like 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0542s0040.1.p |