PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g12760
Common NameGSCOC_T00031995001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MIKC_MADS
Protein Properties Length: 273aa    MW: 31754.1 Da    PI: 8.2309
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g12760genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.12e-27959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++ rqvtfskRr g+lKK +ELSvLCda++ +iifs++gkl+ey+s
  Cc10_g12760  9 KRIENNTSRQVTFSKRRSGLLKKTHELSVLCDAQIGLIIFSNKGKLFEYCS 59
                 79***********************************************96 PP

2K-box622.3e-2183170794
        K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                  ++l+++++e+   el+++k+e+ nLq ++ +++G+dL+s  + eL+qLeqqLe s++k+R++K ell +q+e+l++ ek l++en+++
  Cc10_g12760  83 EDLAKSHNERVFGELKRMKSETLNLQLSLQRYKGDDLSSAHYDELNQLEQQLELSVTKVRARKFELLDQQLENLKRTEKLLEKENQEM 170
                  558899999****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
CDDcd002653.01E-42278No hitNo description
SuperFamilySSF554552.49E-31281IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.8E-1987172IPR002487Transcription factor, K-box
PROSITE profilePS5129713.53290180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRGKIELKR IENNTSRQVT FSKRRSGLLK KTHELSVLCD AQIGLIIFSN KGKLFEYCSH  60
PLSIDQIIER YLKTKGTSIP DHEDLAKSHN ERVFGELKRM KSETLNLQLS LQRYKGDDLS  120
SAHYDELNQL EQQLELSVTK VRARKFELLD QQLENLKRTE KLLEKENQEM CTWLMSNYYQ  180
KQRVELEHSH QQAMTELKLV GQHSILDQFP FSGEEQPSEV LQLANLPLNI HQYRLQPIQP  240
NLQDYGQPGC SYGTHRRHHP YTKVHVLTSD CV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-18171169MEF2C
5f28_B3e-18171169MEF2C
5f28_C3e-18171169MEF2C
5f28_D3e-18171169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027150522.10.0MADS-box protein defh21-like
RefseqXP_027150561.10.0MADS-box protein defh21-like
SwissprotQ8RVL41e-100DEF21_ANTMA; MADS-box protein defh21
TrEMBLA0A068URQ50.0A0A068URQ5_COFCA; Uncharacterized protein
STRINGMigut.C01064.1.p1e-110(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.24e-59MIKC_MADS family protein