PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g02160
Common NameGSCOC_T00024714001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25776.4 Da    PI: 9.8927
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g02160genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.97.5e-30959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvt+skRrng++KKA+EL vLCda+v++i++sst+kl+ey+s
  Cc10_g02160  9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMVSSTQKLHEYIS 59
                 79***********************************************86 PP

2K-box95.77.3e-3271168198
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  yqk+ g++l+++++e++q++l+kLk+ ++nL++e+R+++Ge+L++Ls+ eL  L +++++sl+ iR++K++++ +qie+ +kk ++++e++++L  +l
  Cc10_g02160  71 YQKAVGVDLWSSHHEKMQEQLKKLKEVNRNLRKEIRQRMGESLNDLSYDELGFLIEDVDNSLRAIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLEL 168
                  799999***************************************************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.174161IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.03E-38280No hitNo description
PRINTSPR004041.8E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-35395IPR002100Transcription factor, MADS-box
PfamPF003192.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1982167IPR002487Transcription factor, K-box
PROSITE profilePS5129715.5984174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMVSS TQKLHEYISP  60
TATTKQLVDQ YQKAVGVDLW SSHHEKMQEQ LKKLKEVNRN LRKEIRQRMG ESLNDLSYDE  120
LGFLIEDVDN SLRAIRERKY KVIGNQIETH KKKVRNVEEI HRNLLLELDA RGEDPHYGLV  180
DNGGGDYNPV LGYPRVLALR FQPTQPNLHS GGGSSDLTTF ALLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-16159159MEF2C
5f28_B3e-16159159MEF2C
5f28_C3e-16159159MEF2C
5f28_D3e-16159159MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU3322870.0GU332287.1 Coffea arabica MADS-box protein DEF subfamily (C12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027090983.11e-166floral homeotic protein DEFICIENS-like
SwissprotP237061e-129DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A068UG321e-165A0A068UG32_COFCA; Uncharacterized protein
TrEMBLE9JTW61e-165E9JTW6_COFAR; AP3
STRINGXP_009794650.11e-121(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-90MIKC_MADS family protein
Publications ? help Back to Top
  1. Schwarz-Sommer Z, et al.
    Characterization of the Antirrhinum floral homeotic MADS-box gene deficiens: evidence for DNA binding and autoregulation of its persistent expression throughout flower development.
    EMBO J., 1992. 11(1): p. 251-63
    [PMID:1346760]
  2. Sommer H, et al.
    Deficiens, a homeotic gene involved in the control of flower morphogenesis in Antirrhinum majus: the protein shows homology to transcription factors.
    EMBO J., 1990. 9(3): p. 605-13
    [PMID:1968830]
  3. Gallois JL, et al.
    Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana.
    Gene, 2013. 526(2): p. 299-308
    [PMID:23747397]
  4. Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H
    Multiple interactions amongst floral homeotic MADS box proteins.
    EMBO J., 1996. 15(16): p. 4330-43
    [PMID:8861961]