PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g10310
Common NameGSCOC_T00037134001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25804.4 Da    PI: 10.0261
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g10310genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93.2e-291059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +ien++nrqvt+skRrngi+KKA+ELSvLCda+v++i++s t k++ey s
  Cc07_g10310 10 KIENSTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMLSDTKKFHEYTS 59
                 69**********************************************75 PP

2K-box81.71.7e-2771169199
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  yq++ g++l+++++e++q++l++Lk+ +++L+r +R+++GedL++L+  ++ +L++++ +sl  iR +K++++++q+++ +kk ++l+e++ +L  +l
  Cc07_g10310  71 YQSAVGVDLWSTHYEKMQENLRRLKETNNKLRRDIRQRMGEDLNDLNWDNMCRLQEKIVDSLAIIRHRKYHVIKNQTDTYKKKVRNLKERHGNLLYEL 168
                  78889999************************************************************************************998776 PP

        K-box  99 e 99 
                  e
  Cc07_g10310 169 E 169
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.805161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002657.83E-38280No hitNo description
SuperFamilySSF554552.62E-36295IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-26323IPR002100Transcription factor, MADS-box
PfamPF003199.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-1882168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.63284174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRGKIEIRK IENSTNRQVT YSKRRNGIFK KAHELSVLCD AKVSLIMLSD TKKFHEYTSP  60
SITTKKVMDD YQSAVGVDLW STHYEKMQEN LRRLKETNNK LRRDIRQRMG EDLNDLNWDN  120
MCRLQEKIVD SLAIIRHRKY HVIKNQTDTY KKKVRNLKER HGNLLYELEA RSCEDPKYGI  180
VDNARDYNSA LALADGGLSN LYALRLQYSS HPNLQDLRLA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-15162162MEF2C
5f28_B5e-15162162MEF2C
5f28_C5e-15162162MEF2C
5f28_D5e-15162162MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU3322860.0GU332286.1 Coffea arabica MADS-box protein DEF subfamily (C09) mRNA, complete cds.
GenBankKJ4832380.0KJ483238.1 Coffea arabica TM6 (TM6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073264.11e-159floral homeotic protein DEFICIENS-like
SwissprotQ003J21e-108TM6_VITVI; Agamous-like MADS-box protein TM6
TrEMBLA0A068U2V31e-161A0A068U2V3_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000091121e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]