PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g28980
Common NameGSCOC_T00018199001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MIKC_MADS
Protein Properties Length: 190aa    MW: 21431.1 Da    PI: 8.1075
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g28980genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.7e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien   rqvtfskRrng+lKKA+EL vLCdaevaviifs+tgkl+e++s
  Cc02_g28980  9 KKIENANSRQVTFSKRRNGLLKKAYELGVLCDAEVAVIIFSNTGKLFEFAS 59
                 68***********************************************86 PP

2K-box561.8e-19921531980
        K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 
                  +e + Lk+eie+L+ ++ ++lG+dL+ L lkeLq++eqqL+++l++i+++K+++l++q+e+ 
  Cc02_g28980  92 KEEDILKEEIEKLKLKHSQMLGKDLDGLGLKELQEVEQQLNEGLSSIKARKERMLMDQLEQA 153
                  57789******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.884161IPR002100Transcription factor, MADS-box
SMARTSM004326.1E-42160IPR002100Transcription factor, MADS-box
CDDcd002651.44E-44272No hitNo description
SuperFamilySSF554551.44E-33280IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.09287189IPR002487Transcription factor, K-box
PfamPF014865.8E-1491153IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGRGKIEIKK IENANSRQVT FSKRRNGLLK KAYELGVLCD AEVAVIIFSN TGKLFEFASS  60
SMPQIIARYN KCFEPSECAT VEHQREPLQG PKEEDILKEE IEKLKLKHSQ MLGKDLDGLG  120
LKELQEVEQQ LNEGLSSIKA RKERMLMDQL EQAMMQVYQS ISIFALCGLL IVQVKSLACT  180
FCYLRGINI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-25180180MEF2C
5f28_B3e-25180180MEF2C
5f28_C3e-25180180MEF2C
5f28_D3e-25180180MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027163557.11e-107MADS-box transcription factor 23-like
SwissprotQ388471e-49AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLA0A068V6G41e-134A0A068V6G4_COFCA; Uncharacterized protein
STRINGVIT_13s0158g00100.t012e-65(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87752226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.14e-41AGAMOUS-like 15
Publications ? help Back to Top
  1. Zheng Q,Zheng Y,Perry SE
    Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max.
    Plant Signal Behav, 2014.
    [PMID:23838957]
  2. Perry SE,Zheng Q,Zheng Y
    Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state.
    Plant Signal Behav, 2016. 11(7): p. e1197463
    [PMID:27302197]
  3. Cosio C, et al.
    The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation.
    New Phytol., 2017. 213(1): p. 250-263
    [PMID:27513887]
  4. Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE
    Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis.
    Plant Physiol., 2016. 172(4): p. 2374-2387
    [PMID:27794101]
  5. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]