PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc02_g03570
Common NameGSCOC_T00020244001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26359.2 Da    PI: 9.5954
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc02_g03570genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.31.3e-302473251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  Cc02_g03570 24 RIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSQKGKLYEFSS 73
                 8***********************************************96 PP

2K-box69.11.5e-2396184997
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                    e+  ++l+ e+ ++ + ie L+ +qR+llG+dL+s sl+eLqq+ +qLe+sl+++R++K++l++e+ie+l+ ke  l een +L++k
  Cc02_g03570  96 DIEKYIQELKLEAINMANTIEFLEASQRKLLGQDLGSSSLEELQQIDSQLERSLTNVRARKTQLFKEEIERLKAKEMLLLEENARLSQK 184
                  346668999******************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.8141575IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-421574IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001771IPR002100Transcription factor, MADS-box
CDDcd002657.27E-421786No hitNo description
SuperFamilySSF554551.96E-331792IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-321737IPR002100Transcription factor, MADS-box
PfamPF003193.2E-272471IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-323752IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-325273IPR002100Transcription factor, MADS-box
PfamPF014868.5E-24101185IPR002487Transcription factor, K-box
PROSITE profilePS5129714.562101191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLVGDLGSHT TSRKMVRGKI QMRRIENATS RQVTFSKRRN GLLKKAYELS VLCDAEVALI  60
IFSQKGKLYE FSSSNMQKTI DKYRGCVKED QRSDQDIEKY IQELKLEAIN MANTIEFLEA  120
SQRKLLGQDL GSSSLEELQQ IDSQLERSLT NVRARKTQLF KEEIERLKAK EMLLLEENAR  180
LSQKCGLGSW HAPAKRKEIG SCSQSTQSSE VETGLFIGLP ETRVLEYRRF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-211583169MEF2C
5f28_B6e-211583169MEF2C
5f28_C6e-211583169MEF2C
5f28_D6e-211583169MEF2C
6byy_A5e-211583169MEF2 CHIMERA
6byy_B5e-211583169MEF2 CHIMERA
6byy_C5e-211583169MEF2 CHIMERA
6byy_D5e-211583169MEF2 CHIMERA
6bz1_A6e-211583169MEF2 CHIMERA
6bz1_B6e-211583169MEF2 CHIMERA
6bz1_C6e-211583169MEF2 CHIMERA
6bz1_D6e-211583169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4832400.0KJ483240.1 Coffea arabica AGL42 (AGL42) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027103881.11e-167MADS-box protein AGL42-like
SwissprotQ9FIS18e-82AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A068UCB21e-166A0A068UCB2_COFCA; Uncharacterized protein
STRINGXP_006490292.13e-90(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.34e-84AGAMOUS-like 42