PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_48539

Common Name

KK1_050225

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

NAC

Protein Properties

Length: 56aa MW: 6562.53 Da PI: 6.4992

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_48539	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	58.9	1.7e-18	1	52	1	53
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53 lppGfrFhPtdee v +yL++k++++++ + +i+e+d+yk++PwdLp k+k+ C.cajan_48539 1 LPPGFRFHPTDEEHVLHYLCPKCASHQIVV-PIITEIDLYKYDPWDLPGKIKH 52 79***********************999.88*************76655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	20.533	1	56	IPR003441	NAC domain
SuperFamily	SSF101941	3.14E-19	1	51	IPR003441	NAC domain
Pfam	PF02365	5.8E-7	2	44	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
LPPGFRFHPT DEEHVLHYLC PKCASHQIVV PIITEIDLYK YDPWDLPGKI KHTHTD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-20	1	47	15	61	Stress-induced transcription factor NAC1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_48539

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020236522.1	3e-25	NAC domain-containing protein 2
Swissprot	Q39013	3e-23	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A151UEV7	2e-33	A0A151UEV7_CAJCA; NAC domain-containing protein 2 (Fragment)
STRING	XP_002520341.1	3e-23	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF11433	17	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-25	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]