PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_48342
Common NameKK1_046318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 346aa    MW: 40047.1 Da    PI: 6.2743
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_48342genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.15.7e-5651341129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeelv +yL+kkv+++k++l +vike+d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+
  C.cajan_48342   5 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIKEIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKSVY 99 
                    69****************************.9***************953432233667************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + +++l+g++ktLvfykgrap+g+ktdW+mheyrle
  C.cajan_48342 100 E-RTKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 134
                    *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-573165IPR003441NAC domain
PROSITE profilePS5100558.1625165IPR003441NAC domain
PfamPF023657.1E-296133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MESCVPPGFR FHPTDEELVG YYLRKKVASQ KIDLDVIKEI DLYRIEPWDL QERCRIGYEE  60
QNEWYFFSHK DKKYPTGTRT NRATMAGFWK ATGRDKSVYE RTKLIGMRKT LVFYKGRAPN  120
GQKTDWIMHE YRLETVENGP PQATFKRIIE CVQEEGWVVC RAFRKRTNGQ TKTIEGWDRS  180
YLYDEQASGV NSGVDPIDLI IRQQPQSFSA QSFLYKQEMI EAESLSFMHA DQLVQLPQLE  240
SPSLPLLKKQ TSVSTLISNQ DDYQKGLSSN TKKVTDWRDL DKFVASQLSQ EERHEIEGVS  300
SFATHTSSDM PLLLLQNSRD NEGNKLNPFL NTSSSDCDIG ICVFEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-52216712170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_48342
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0941621e-147BT094162.1 Soybean clone JCVI-FLGm-18C16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020208055.10.0NAC domain-containing protein 37
SwissprotQ9SL411e-147NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A151QRF70.0A0A151QRF7_CAJCA; NAC domain-containing protein 7
STRINGXP_007156123.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-135vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]