PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_46578
Common NameKK1_044033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 356aa    MW: 40014.4 Da    PI: 8.9286
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_46578genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.7e-55181451128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp k+k ++kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+l++ 
  C.cajan_46578  18 LPPGFRFHPTDEELISYYLINKISDSDFTG-KAIADVDLNKCEPWELPGKAKMGQKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEILNSv 112
                    79*************************999.88***************999999***************************************997 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++e vg+kktLvfykgrap+gekt+Wvmheyr+
  C.cajan_46578 113 TSEFVGMKKTLVFYKGRAPRGEKTNWVMHEYRI 145
                    8889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6314167IPR003441NAC domain
PROSITE profilePS5100560.61118167IPR003441NAC domain
PfamPF023651.2E-2819145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
KEGKSIEMEG THEKEETLPP GFRFHPTDEE LISYYLINKI SDSDFTGKAI ADVDLNKCEP  60
WELPGKAKMG QKEWYFFSLR DRKYPTGVRT NRATNTGYWK TTGKDKEILN SVTSEFVGMK  120
KTLVFYKGRA PRGEKTNWVM HEYRIHSKST FKINKQEEWV VCRVFRKSGG AKKFPSSTHT  180
RAVMNPYNLE VGPSIMPPPM MHLPDPTSHF LYGRNYMLSN AEVAEVTRLL RNGAGSTTVM  240
NLPMMQQHHH LNNPVAAAGG GFTISGLNLN LGGGTVAATT QTQHLLRPMM LPPQPSPAHT  300
MVHGHDHFSS NMVTPNALAP ENVAYGGADM NTANSQGNRY MDMDHCVDLD NYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-561717316171NO APICAL MERISTEM PROTEIN
1ut4_B6e-561717316171NO APICAL MERISTEM PROTEIN
1ut7_A6e-561717316171NO APICAL MERISTEM PROTEIN
1ut7_B6e-561717316171NO APICAL MERISTEM PROTEIN
3swm_A7e-561717319174NAC domain-containing protein 19
3swm_B7e-561717319174NAC domain-containing protein 19
3swm_C7e-561717319174NAC domain-containing protein 19
3swm_D7e-561717319174NAC domain-containing protein 19
3swp_A7e-561717319174NAC domain-containing protein 19
3swp_B7e-561717319174NAC domain-containing protein 19
3swp_C7e-561717319174NAC domain-containing protein 19
3swp_D7e-561717319174NAC domain-containing protein 19
4dul_A6e-561717316171NAC domain-containing protein 19
4dul_B6e-561717316171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_46578
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150366e-91AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029125793.10.0protein CUP-SHAPED COTYLEDON 1 isoform X1
TrEMBLA0A151QXL30.0A0A151QXL3_CAJCA; Protein CUP-SHAPED COTYLEDON 2 (Fragment)
STRINGGLYMA14G20276.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-111NAC domain containing protein 38