PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43786
Common NameKK1_046381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 330aa    MW: 37050.8 Da    PI: 7.0076
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43786genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51141391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Ptdeel+v+yL++kv+g++++l  +i+evd+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +
  C.cajan_43786  14 LPPGFRFFPTDEELLVQYLCRKVAGHHFSL-PIIAEVDLYKFDPWVLPGKAVFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITN-E 107
                    79**************************99.88***************7777899*************************************99.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  C.cajan_43786 108 GRKVGIKKALVFYVGKAPKGSKTNWIMHEYRL 139
                    99****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6510165IPR003441NAC domain
PROSITE profilePS5100560.10714164IPR003441NAC domain
PfamPF023657.9E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGVPERDPLV QLSLPPGFRF FPTDEELLVQ YLCRKVAGHH FSLPIIAEVD LYKFDPWVLP  60
GKAVFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITNEGRK VGIKKALVFY  120
VGKAPKGSKT NWIMHEYRLL DSSRKNNLGT TKLDDWVLCR IYKKNSSAQN VGASLGAKEC  180
SNGSSSPSSS SHVDDILESF PEIDDQCFTL PRVNSLRTMQ QDEKFGFQNM GTEFFADWVN  240
QTEQDSVSGF GSGMMNYNCN DLFVPSMPSL FSHVDFMTGA PTEEEVQSGM RTQRADGPKC  300
FQSNPKAQLL SGQLDPFEFG YMGQQFGLRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10511704171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10511704171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10511704171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10511704171NO APICAL MERISTEM PROTEIN
4dul_A1e-10511704171NAC domain-containing protein 19
4dul_B1e-10511704171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_43786
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312160.0KT031216.1 Glycine max clone HN_CCL_3 NAC transcription factor (Glyma12g22880.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020208087.10.0NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-120JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A151QRB00.0A0A151QRB0_CAJCA; NAC domain-containing protein 72
STRINGGLYMA12G22880.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-116NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]