PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43030
Common NameKK1_039488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 338aa    MW: 37852.7 Da    PI: 7.8374
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43030genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52141391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +
  C.cajan_43030  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-E 107
                    79***************************9.89***************7777799***********************************9999.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  C.cajan_43030 108 GRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                    99****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6510164IPR003441NAC domain
PROSITE profilePS5100560.21514163IPR003441NAC domain
PfamPF023653.4E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGVPERDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLL DSSRKNNGGT KLDDWVLCRI YKKNSSAQKA AQNGVVSSNE  180
HTQYSNGSSS SSSSHLDEVL ESLPEIDESC FMVPRVNAMP QHREEKLNLG AGGLMDWANP  240
VLSSVGDFVS GNPMVQAQTQ GMVNYSGPGC NDLYVPTLCH VDSSLPQKVE EEVQSGVRNQ  300
RLENSWFLQN DFAQGFTNSV DTCGFKYPVQ PVGFGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10911697174NAC domain-containing protein 19
3swm_B1e-10911697174NAC domain-containing protein 19
3swm_C1e-10911697174NAC domain-containing protein 19
3swm_D1e-10911697174NAC domain-containing protein 19
3swp_A1e-10911697174NAC domain-containing protein 19
3swp_B1e-10911697174NAC domain-containing protein 19
3swp_C1e-10911697174NAC domain-containing protein 19
3swp_D1e-10911697174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_43030
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619240.0EU661924.1 Glycine max NAC domain protein (NAC27) mRNA, complete cds.
GenBankKT0312180.0KT031218.1 Glycine max clone HN_CCL_59 NAC transcription factor (Glyma13g35550.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020203278.10.0NAC domain-containing protein 72
SwissprotQ9SQL01e-137JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A151R9B30.0A0A151R9B3_CAJCA; NAC domain-containing protein 55
STRINGXP_007149614.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-119NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]