PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_38763
Common NameKK1_041302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 271aa    MW: 31184.2 Da    PI: 7.3601
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_38763genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.1e-51101381129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrF P+deelv++yL kk++++++    ++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v++  
  C.cajan_38763  10 LPPGFRFYPSDEELVCHYLYKKIANEQVLK-GTLVEIDLHICEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVMDPa 104
                    79************************9655.78***************88888999**************************************97 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                    ++e+vg++ktLvfy++rap+g kt W+mhe+rle
  C.cajan_38763 105 TQEVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                    8888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-618156IPR003441NAC domain
PROSITE profilePS5100557.58610156IPR003441NAC domain
PfamPF023657.2E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVCHYLYK KIANEQVLKG TLVEIDLHIC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV MDPATQEVVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKEE NSSKQLMYET TTPPSSLTLA  180
SSSPPNQTMP PGGYNRFSSS MPTHHHHHFN PNQSTSLLFS RTNTTQISCK PHDDGYAFLW  240
DMELEDGVAS NLDAIRFEVD NNNNNNNMVL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-47915616165NO APICAL MERISTEM PROTEIN
1ut4_B2e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_A2e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_B2e-47915616165NO APICAL MERISTEM PROTEIN
4dul_A2e-47915616165NAC domain-containing protein 19
4dul_B2e-47915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_38763
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0893651e-170BT089365.1 Soybean clone JCVI-FLGm-1D22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020204792.10.0NAC domain-containing protein 21/22
SwissprotQ84TE63e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A151R4H40.0A0A151R4H4_CAJCA; NAC domain-containing protein 21/22
STRINGGLYMA19G34881.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-94NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]