PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_32331
Common NameKK1_032596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 404aa    MW: 45563.4 Da    PI: 9.0212
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_32331genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52141411128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ 
  C.cajan_32331  14 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSe 108
                    579***************************.89***************9888999***************************************95 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  C.cajan_32331 109 GSKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 141
                    6677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5713173IPR003441NAC domain
PROSITE profilePS5100556.93814173IPR003441NAC domain
PfamPF023651.6E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MEERNDGEKL DEVMLPGFRF HPTDEELVGF YLKRKIQQRP LSIELIKQLD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGS KCIGLKKSLV  120
FYKGRAAKGI KTDWMMHEFR LPSLTPSSSS PKKYMDKNIP ANESWAICRI FKKTNATAQR  180
ALSHSWVSPL PETTTSDHML TTDRNSNQFF PSNMPLAKKT SLASQFCTFN HNDTQHLTTS  240
SSTPCPLDVV ASYNKPIINP LLYKPLDRLP FSNGDLSTGS IFSSPLETST TSAKSSMEYF  300
SSLLSSSVHG EFSKTSEGTT TNFGGLQEHH SNGYHVPILR DMQGTIGNHD NNVLVKIPNN  360
VNVPRVDDQQ LETGRSIGFP FAMPFNIGDA WKSNLLWDTS SLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-531618019171NO APICAL MERISTEM PROTEIN
1ut4_B1e-531618019171NO APICAL MERISTEM PROTEIN
1ut7_A1e-531618019171NO APICAL MERISTEM PROTEIN
1ut7_B1e-531618019171NO APICAL MERISTEM PROTEIN
3swm_A2e-531618022174NAC domain-containing protein 19
3swm_B2e-531618022174NAC domain-containing protein 19
3swm_C2e-531618022174NAC domain-containing protein 19
3swm_D2e-531618022174NAC domain-containing protein 19
3swp_A2e-531618022174NAC domain-containing protein 19
3swp_B2e-531618022174NAC domain-containing protein 19
3swp_C2e-531618022174NAC domain-containing protein 19
3swp_D2e-531618022174NAC domain-containing protein 19
4dul_A1e-531618019171NAC domain-containing protein 19
4dul_B1e-531618019171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_32331
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020236373.20.0LOW QUALITY PROTEIN: putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-110FEZ_ARATH; Protein FEZ
TrEMBLA0A151RTG30.0A0A151RTG3_CAJCA; Putative NAC domain-containing protein 9
STRINGXP_007158658.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-112NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]