![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_30485 | ||||||||
Common Name | KK1_033045 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 225aa MW: 25795.1 Da PI: 9.7414 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.2 | 7.1e-32 | 3 | 75 | 55 | 128 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 e+ewyfFs+r++ky++g r+nrat sgyWkatg+dk+++s +++++g+kk Lvfykg+ pkg ktdW+mheyrl C.cajan_30485 3 ENEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDKAIYS-GSKHIGVKKALVFYKGKPPKGIKTDWIMHEYRL 75 68**************************************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 41.346 | 1 | 102 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 4.45E-39 | 1 | 102 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-14 | 6 | 75 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
FGENEWYFFS PRERKYPNGV RPNRATVSGY WKATGTDKAI YSGSKHIGVK KALVFYKGKP 60 PKGIKTDWIM HEYRLIGSRR QANRQIGSMR LDDWVLCRIY KKKNMGKSLE AREDYPISQI 120 NIAPANNDSD QHEVMKFPRT SSLTHLLEMD YLGPISHILS DGSFNSTFDF QINTDNGGID 180 PFVKPQLVEM PNNDPYASDS GKYQVKQNST LNPTIFVNQV YDQRG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-46 | 1 | 104 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-46 | 1 | 104 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-46 | 1 | 104 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-46 | 1 | 104 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-46 | 1 | 104 | 71 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-46 | 1 | 104 | 68 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-46 | 1 | 104 | 68 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_30485 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ028769 | 0.0 | DQ028769.1 Glycine max NAC domain protein NAC1 (NAC1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020236754.1 | 1e-170 | NAC domain-containing protein 1 | ||||
Swissprot | K4BWV2 | 9e-78 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A151RS82 | 1e-168 | A0A151RS82_CAJCA; NAC domain-containing protein 29 (Fragment) | ||||
STRING | GLYMA01G06150.1 | 1e-148 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4103 | 32 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-76 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|