PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_19098
Common NameKK1_019653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 216aa    MW: 24872.2 Da    PI: 9.8901
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_19098genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.15.8e-5271281128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp +    e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk++++  
  C.cajan_19098   7 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPEVDVCKSDPWDLPGE---LEQERYFFSTKEAKYPNGNRSNRATNSGYWKATGLDKQIVT-- 96 
                    79****************************.89***************55...46799***********************************9.. PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++vg+kktLvfy+g+ p+g++tdW+mheyrl
  C.cajan_19098  97 NQVVGMKKTLVFYRGKPPHGSRTDWIMHEYRL 128
                    889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-594153IPR003441NAC domain
PROSITE profilePS5100557.467153IPR003441NAC domain
PfamPF023651.1E-278128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEKVLRLPPG FRFHPTDEEL VVQYLKRKVF SCPLPASIIP EVDVCKSDPW DLPGELEQER  60
YFFSTKEAKY PNGNRSNRAT NSGYWKATGL DKQIVTNQVV GMKKTLVFYR GKPPHGSRTD  120
WIMHEYRLLN INNSSPSSKS PLENWVLCRI FLKRRSGAKS LDNIRKVKNS KLVFYDFLAQ  180
NKTDSSSSSG ITELSDHEHE ESSSSNTFPY FRTKQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54515915171NO APICAL MERISTEM PROTEIN
1ut4_B2e-54515915171NO APICAL MERISTEM PROTEIN
1ut7_A2e-54515915171NO APICAL MERISTEM PROTEIN
1ut7_B2e-54515915171NO APICAL MERISTEM PROTEIN
3swm_A2e-54515918174NAC domain-containing protein 19
3swm_B2e-54515918174NAC domain-containing protein 19
3swm_C2e-54515918174NAC domain-containing protein 19
3swm_D2e-54515918174NAC domain-containing protein 19
3swp_A2e-54515918174NAC domain-containing protein 19
3swp_B2e-54515918174NAC domain-containing protein 19
3swp_C2e-54515918174NAC domain-containing protein 19
3swp_D2e-54515918174NAC domain-containing protein 19
4dul_A2e-54515915171NAC domain-containing protein 19
4dul_B2e-54515915171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_19098
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020219107.11e-161NAC domain-containing protein 83
SwissprotQ9FY937e-91NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A151TDB91e-160A0A151TDB9_CAJCA; NAC domain-containing protein 29
STRINGGLYMA18G53954.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-88NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]