PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18948
Common NameKK1_019500, KK1_037082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 348aa    MW: 39723.8 Da    PI: 6.7676
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18948genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.3e-52221491128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeel+++yL+ kv +++++    ++evd++++ePw+Lp  +k +e+ewy Fs rd+ky+tg r+nrat +gyWkatgkdkev+s+ 
  C.cajan_18948  22 LPPGFRFHPTDEELITFYLASKVFNETFTN-VKFAEVDLNRCEPWELPDVAKMGEREWYLFSLRDRKYPTGLRTNRATGAGYWKATGKDKEVYSAs 116
                    79*************************888.45***************8888899**************************************997 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +g+l g+kktLvfykgrap+gekt+Wvmheyrl
  C.cajan_18948 117 SGTLLGMKKTLVFYKGRAPRGEKTKWVMHEYRL 149
                    7888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6217169IPR003441NAC domain
PROSITE profilePS5100559.09922169IPR003441NAC domain
PfamPF023658.6E-2723149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MLVMEEVLCE LSDHEKRNEQ GLPPGFRFHP TDEELITFYL ASKVFNETFT NVKFAEVDLN  60
RCEPWELPDV AKMGEREWYL FSLRDRKYPT GLRTNRATGA GYWKATGKDK EVYSASSGTL  120
LGMKKTLVFY KGRAPRGEKT KWVMHEYRLD AHFSHTSKEE WVICRIFHKS GEKRTPLLQL  180
QGHSDASSPS LLASPTSFTL ELECQSQSPL MIHHQQDQNH LSHPHLFPLH ATNHSSISDL  240
FLKAKEQTLA KLIKTEDDAN ATLYQHHSLD DPNNSFRWEN KLNHNINQGH FMNPVPLEVD  300
AGLMAFSGAA NAEVRDMSTS TVFNRVGLQQ VLDAAHIGID SWPMPQHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-521917212171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_18948
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020219760.10.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_020240137.10.0protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8512e-93NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A151RGE80.0A0A151RGE8_CAJCA; Protein CUP-SHAPED COTYLEDON 3
STRINGXP_007135979.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-95NAC family protein
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]