PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_11824
Common NameKK1_012187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 422aa    MW: 47888 Da    PI: 6.6569
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_11824genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52151412128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                     pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +
  C.cajan_11824  15 LPGFRFHPTDEELVGFYLKRKIQQRPLTI-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeG 109
                    69*************************99.89***************8888999***************************************956 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  C.cajan_11824 110 SKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 141
                    677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5713169IPR003441NAC domain
PROSITE profilePS5100557.2814169IPR003441NAC domain
PfamPF023651.5E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MEERNDAEKL DEVILPGFRF HPTDEELVGF YLKRKIQQRP LTIELIKQLD IYKYDPWDLP  60
KLATTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGS KCIGLKKSLV  120
FYKGRAAKGV KTDWMMHEFR LPSLTDSLSP KYIDKTIPES WAICRIFKKT NSTAQRALSH  180
SWVSSLPETR TSDILTKDQD STQFCSPNMP LPKKTSLTSQ FCTNNYNDAQ PLTTNSCSSS  240
TLCPLDVASY KSIINPLLYK AFDHFPISNG DLSTNLLFSS PFETSDPNAK STMDVSSMLL  300
NMSSSVLGDL NKTSEDTNTS TNFGELQEHC SGYPIPFLRE MQTTFGNQQY YDNVNALVKV  360
PNVNVPRVDD QELELESVRS IGFPFSSMPF NIGDAWKSNL LWDTSSFPCD VPSSYSTTKC  420
YT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-531617619171NO APICAL MERISTEM PROTEIN
1ut4_B5e-531617619171NO APICAL MERISTEM PROTEIN
1ut7_A5e-531617619171NO APICAL MERISTEM PROTEIN
1ut7_B5e-531617619171NO APICAL MERISTEM PROTEIN
4dul_A5e-531617619171NAC domain-containing protein 19
4dul_B5e-531617619171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_11824
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619280.0EU661928.1 Glycine max NAC domain protein (NAC36) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020216106.10.0protein FEZ
SwissprotQ9ZVH01e-107FEZ_ARATH; Protein FEZ
TrEMBLA0A151TFU20.0A0A151TFU2_CAJCA; Putative NAC domain-containing protein 9
STRINGGLYMA02G11900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-105NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]